Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR450 IGR451 IGR449 IGR452 CPn0565 CPn0562 recJ, - CPn0563 secF,secD, - CPn0564 CPn0566 cdsA, - CPn0567 CPn0565 CPn0562 recJ, - CPn0563 secF,secD, - CPn0564 CPn0566 cdsA, - CPn0567 CPn0565 CPn0562 recJ, - CPn0563 secF,secD, - CPn0564 cdsA, - CPn0567 CPn0566
* Calculated from Protein Sequence

Gene ID: CPn0564

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
secF  secD  

Definition:
protein translocation membrane protein SECF

Gene Start:
654350

Gene Stop:
650142

Gene Length:
4209

Molecular Weight*:
156831

pI*:
7.60

Net Charge*:
8.55

EC:
 

Functional Class:
cellular processes; standard protein secretion  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to protein-export membrane protein sequences; e.g. residues 1-1401 are 59% similar to CT448; residues 839-1058 are 41% similar to TP0410; residues 1224-1387 are 355 similar to TP0411; residues 851-1392 are 28% similar to (Z99118) protein-export membrane protein [Bacillus subtilis]; and residues 832-1069 are 38% similar to (AE000652) protein-export membrane protein (secD) [Helicobacter pylori 26695].

COGS Summary:  COGS Search
BeTs to 12 clades of COG0342
COG name: Preprotein translocase subunits SecD
Functional Class:  N
The phylogenetic pattern of COG0342 is -mtk-qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 833-1051 are 39% similar to a defined domain of Q55610_XXXXX, defined as: PROTEIN MEMBRANE PROTEIN-EXPORT TRANSMEMBRANE TRANSPORT TRANSLOCATION SECD SECF INNER EXPORT.
Residues 1224-1394 are 41% similar to a defined domain of O33568_XXXXX, defined as: PROTEIN MEMBRANE PROTEIN-EXPORT TRANSMEMBRANE TRANSPORT TRANSLOCATION SECD SECF INNER EXPORT.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1100 to 1397 (E-value = 1.7e-134) place CPn0564 in the SecD_SecF family which is described as Protein export membrane protein (PF02355)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19
non-globular  
197  
270
transmembrane  
916  
933
transmembrane  
938  
955
transmembrane  
960  
977
transmembrane  
1012  
1029
transmembrane  
1034  
1053
transmembrane  
1093  
1110
transmembrane  
1239  
1256
transmembrane  
1266  
1283
transmembrane  
1288  
1305
transmembrane  
1341  
1358
transmembrane  
1363  
1382

PDB Hit:


Gene Protein Sequence:
MKQKVKRNFAIIICVFALALYYVLPTCLYYAKPLDKKIDGNEAEHIIKSF
TKQAQQVRKDVIPRVSAILSSLHLRGHIQQHPAIPDIVSVRFKRGEDAED
FIGNLVHGEPNVPIKSARLHVVGYSREHDDHVIQVASSINTSLVESDFSF
VSYSSENEQEMASSILQRVYSACTFPKQKDCSCSYPSIWETAPKEQLLQY
AKNLSSGFEVFSSRLSAFCQQSFSSNQDRLAFLSRLSSLSNDAAIDVEDQ
KLLKSVYETLSQTACIRSLDCPYIEGLRLDCSESSLFFSSIEYCPKERKI
FLTLHSDLLAQRTSLSKEQRLDFDSRLAVEKQKLSKNLTVQVEDYNNGFS
FQWMDKDTQGKIILQGERLLQGIAEHLTALTLHRPAAESCDLIPENFPVF
CRQPRESEAFGCYIFSPNTDCKHFSKGSVYILLKGLRSIVAKYQQGGGKE
LQSFEKDLQNLYNCFSHTEAISWTLGEDQVLEIRHPLQQFLDVWGEGFVI
GKEGCAFLEVKDIQDRLATVNQIEKNRQSDLVRWHEQYRHAKCSMDLQER
LSAPIPYQNLFLENMKLNMRKFSRGENILRLGIDFVGGRQLLLSFKDHQG
KQLTDKEDILKVSDELCARLNKLGVSEIELRREGDYIHLSVPGSSTISSS
EILGTSKMSFHVVNERFSSYSASRYEVQRFLDYLWFTSQAQGKTSPEEIN
TFASALFNEEVDVPPSVHEAITKLKSEGLAFSPSGCETPSTDLDTTFSMI
AIGKDAEQKANPLVIVFRNYALDGASLKDIRPEFAAGEGYVLNFSVKDTS
PKKMAEKLSPTESFHTWTSAYCQEGISGTANGQYSANRGWRMAVVIDGYM
VSSPILNVPLKNHASVSGKFTHREVSKLASDLKSGAMSFVPEVLSEETIS
SDLGKKQCTQGIISACCGLAMLIVLMSVYYRFGGVIASGAVLLNLLLIWA
ALQYLDAPLTLSGLAGIVLAMGMAVDANVLVFERIREEFLLSQSLKKSVE
KGYTKAFGAIFDSNLTTVLASALLFFLDTGPIKGFALTLILGIFSSMFTA
LFMTKFFFMLWMNKTQHTQLHMMNKFVGIKHDFLRGCKKLWAVSGSVFLL
GCVALGFGAWNSVLGMDFKGGYAFTFNPKEHGISDVAQMRGKVVHKLQEA
GLSSRDFRIQTFGSSEKIKIYFSDKALSYTKADTSLSPKINDHELALAVG
LLSETGLDFSTETLNETQNFWSKVSSKLSKKMRYQATIGLLGALAIILLY
VSLRFEWQYAFSAVCALIHDLLATCAVLFIAHFFLKKIQIDLQAIGALMT
VLGYSLNNTLIIFDRIREDRQANLFTPMHVLVNDALQKTFSRTVMTTATT
LSVLLMLLFIGGSSVFNFAFIMTIGILLGTLSSLYIAPPLLLFMVRKENR
SK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAGAAGGTTAAGCGAAACTTCGCTATCATTATTTGCGTGTTTGC
TTTGGCTTTGTATTACGTTTTGCCTACATGTTTATATTACGCCAAACCTC
TGGATAAGAAAATAGATGGAAACGAAGCCGAACATATAATCAAATCTTTT
ACCAAGCAGGCCCAGCAAGTTCGTAAGGATGTCATTCCTCGCGTCTCAGC
GATCCTTTCGTCCCTACATTTACGTGGGCACATACAACAACATCCTGCGA
TTCCAGATATTGTCAGTGTGCGTTTTAAAAGAGGTGAAGATGCAGAGGAC
TTTATCGGGAACCTCGTTCATGGAGAGCCTAACGTTCCCATAAAGTCTGC
AAGACTCCATGTGGTTGGCTATAGTCGAGAACACGACGACCATGTAATAC
AAGTAGCAAGCTCTATAAATACTTCCTTAGTAGAAAGTGATTTTTCTTTT
GTTTCCTATTCTTCCGAAAATGAACAAGAGATGGCCTCAAGTATTTTGCA
ACGAGTCTATTCTGCATGTACTTTTCCGAAACAAAAAGACTGTTCTTGTA
GTTACCCCTCTATCTGGGAAACGGCACCTAAAGAACAATTGTTACAGTAT
GCCAAGAACCTTTCTTCAGGATTTGAGGTTTTTTCTTCGCGACTTTCAGC
GTTTTGCCAACAGTCCTTTTCTTCCAACCAAGATAGACTTGCGTTTTTAT
CACGCCTGTCTTCGTTGTCAAACGACGCAGCAATCGATGTTGAAGATCAA
AAGCTACTCAAGAGTGTGTATGAAACTCTTTCTCAAACTGCATGCATTCG
TAGTTTAGATTGCCCTTATATTGAAGGGCTTCGATTAGATTGTAGTGAGT
CCTCATTATTTTTTAGTTCCATAGAGTATTGCCCTAAGGAACGTAAAATT
TTCCTGACACTACATTCTGATTTGTTAGCACAGCGTACGTCTTTGTCTAA
AGAACAACGCTTAGATTTTGACAGTCGTTTGGCTGTTGAAAAACAAAAGC
TCTCTAAGAACTTAACTGTTCAAGTAGAAGATTATAACAACGGATTTTCC
TTCCAATGGATGGATAAAGATACTCAGGGAAAGATTATTCTCCAGGGAGA
GCGTTTGCTCCAAGGAATCGCAGAACATCTCACGGCATTAACTTTGCATA
GGCCTGCAGCTGAATCTTGTGACCTGATTCCAGAAAATTTTCCTGTTTTC
TGTCGTCAACCTAGAGAAAGCGAAGCTTTTGGCTGTTACATCTTTTCTCC
CAATACAGATTGCAAACACTTTTCTAAAGGCTCCGTTTACATCTTATTGA
AAGGACTCCGTTCTATCGTCGCGAAATATCAACAGGGAGGGGGTAAAGAA
CTCCAAAGTTTCGAAAAAGATCTACAAAATCTCTATAACTGTTTTTCTCA
TACAGAAGCGATTTCCTGGACTCTAGGAGAAGATCAAGTCTTAGAAATCC
GGCACCCCTTGCAGCAATTTCTAGATGTATGGGGTGAGGGATTTGTCATA
GGGAAAGAGGGCTGTGCCTTTTTAGAAGTTAAAGACATTCAAGATCGCCT
TGCAACTGTAAACCAAATCGAGAAGAATCGTCAAAGCGATTTAGTGCGTT
GGCATGAGCAATACCGACACGCAAAGTGTTCTATGGATCTTCAGGAACGT
TTGAGTGCTCCGATTCCTTATCAAAATCTTTTCTTAGAAAATATGAAACT
CAACATGAGAAAATTTTCTCGTGGGGAGAACATACTACGTCTTGGTATTG
ATTTTGTTGGTGGGCGTCAGCTGCTACTCTCTTTTAAAGATCATCAGGGA
AAGCAGCTCACCGATAAGGAAGATATTCTTAAAGTTTCGGATGAGCTCTG
TGCTCGATTAAATAAACTTGGAGTATCTGAAATCGAACTTCGCCGTGAGG
GAGATTACATTCATCTCAGTGTGCCAGGATCTTCTACGATCTCCTCATCT
GAGATCTTGGGGACCTCAAAAATGAGTTTCCATGTGGTGAATGAGAGGTT
CTCTTCTTACAGCGCTTCCCGCTACGAAGTGCAAAGATTTTTAGACTATC
TTTGGTTTACCTCTCAAGCTCAAGGAAAGACATCTCCCGAAGAAATCAAT
ACCTTCGCTAGCGCCTTATTTAATGAGGAAGTCGATGTGCCTCCAAGTGT
CCATGAGGCCATTACTAAGCTTAAAAGTGAGGGGTTGGCGTTCTCTCCTT
CAGGATGCGAAACGCCTTCGACAGATTTAGATACGACGTTTTCTATGATT
GCTATTGGAAAAGATGCAGAACAAAAAGCAAATCCTTTAGTCATTGTTTT
TAGAAATTATGCGTTAGATGGAGCTTCCCTAAAAGACATTCGTCCAGAAT
TTGCTGCAGGGGAAGGTTATGTTTTAAATTTTTCAGTCAAAGATACAAGC
CCTAAGAAAATGGCAGAGAAACTTTCTCCTACAGAGAGTTTCCACACATG
GACTTCCGCATATTGTCAGGAGGGGATCAGCGGCACTGCTAATGGACAAT
ATTCTGCAAACCGTGGATGGCGTATGGCTGTAGTGATTGACGGTTATATG
GTCAGCAGCCCTATTTTAAACGTCCCATTGAAAAATCATGCCAGTGTCTC
AGGGAAATTTACCCACCGTGAAGTGAGCAAACTCGCCTCAGATTTAAAAT
CTGGAGCGATGTCTTTTGTTCCCGAGGTTCTCAGTGAAGAGACGATCTCT
TCTGATCTTGGGAAAAAACAATGTACACAAGGCATTATCTCAGCATGCTG
TGGCTTGGCAATGCTTATTGTTTTGATGAGCGTATATTATAGATTTGGAG
GCGTCATCGCTTCGGGAGCTGTTCTTCTGAATCTTTTGCTTATCTGGGCA
GCTCTACAGTATTTGGATGCGCCACTCACCTTGTCAGGACTCGCTGGGAT
TGTTCTTGCTATGGGGATGGCCGTAGATGCAAATGTTCTTGTATTCGAAA
GAATCCGAGAGGAATTTTTATTGTCTCAAAGTCTTAAAAAATCTGTAGAA
AAAGGATATACCAAGGCTTTTGGAGCCATTTTTGATTCTAACTTGACTAC
AGTATTGGCCTCAGCACTTCTTTTCTTCCTAGATACAGGGCCTATTAAAG
GGTTTGCTTTGACATTGATTTTAGGAATTTTCTCTTCAATGTTTACGGCT
CTTTTCATGACTAAATTTTTCTTCATGCTGTGGATGAATAAGACCCAACA
TACACAGTTGCATATGATGAATAAGTTCGTGGGGATAAAGCATGATTTCT
TGAGAGGATGCAAAAAACTTTGGGCTGTTTCTGGAAGTGTTTTTCTTTTA
GGTTGCGTTGCTCTCGGGTTTGGAGCCTGGAATTCCGTTTTGGGAATGGA
TTTTAAAGGAGGGTATGCCTTTACCTTTAATCCAAAAGAGCATGGCATCA
GCGATGTTGCTCAAATGCGTGGCAAAGTTGTGCATAAACTACAGGAAGCT
GGTCTTTCTTCTAGAGACTTCCGTATTCAAACATTTGGATCTTCAGAAAA
GATCAAAATCTATTTTAGTGATAAAGCTTTAAGCTATACTAAAGCAGATA
CGAGCCTCTCTCCTAAAATTAACGATCATGAGCTGGCGTTAGCTGTGGGA
TTGTTGTCAGAAACAGGCCTAGATTTCTCTACGGAAACTCTAAACGAAAC
GCAAAATTTTTGGTCAAAGGTAAGCAGCAAACTATCGAAGAAAATGCGTT
ATCAGGCGACCATCGGGCTTTTAGGAGCTTTGGCAATCATCTTGCTCTAT
GTGAGTTTGCGCTTTGAATGGCAATATGCTTTCAGTGCCGTATGCGCTTT
AATTCATGACCTTTTGGCTACCTGTGCAGTCTTGTTTATAGCACATTTCT
TTTTGAAGAAAATTCAAATAGATTTGCAAGCCATTGGTGCTTTAATGACT
GTATTGGGGTATTCATTAAACAATACTTTGATCATTTTTGATCGTATTCG
TGAAGATCGCCAAGCGAACCTGTTTACCCCTATGCATGTTTTAGTTAATG
ATGCCCTTCAAAAGACGTTCAGCCGCACGGTAATGACAACAGCTACAACT
CTATCAGTTTTGTTAATGCTTTTGTTTATAGGCGGCTCCTCTGTCTTTAA
TTTTGCATTTATTATGACCATAGGGATTCTTCTAGGAACTTTATCGTCTC
TTTATATTGCACCACCTCTGTTGTTGTTTATGGTCCGTAAAGAAAATCGC
TCAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy