Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR450 IGR449 IGR447 IGR448 euo, - CPn0561 CPn0562 gltX, - CPn0560 recJ, - CPn0563 secF,secD, - CPn0564 euo, - CPn0561 CPn0562 gltX, - CPn0560 recJ, - CPn0563 secF,secD, - CPn0564 euo, - CPn0561 CPn0562 gltX, - CPn0560 recJ, - CPn0563 secF,secD, - CPn0564
* Calculated from Protein Sequence

Gene ID: CPn0563

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recJ  

Definition:
single-strand DNA-specific exonuclease

Gene Start:
650056

Gene Stop:
648290

Gene Length:
1767

Molecular Weight*:
65069

pI*:
8.10

Net Charge*:
6.38

EC:
3.1.-.-  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0563 is similar to TP0704, a predicted single-strand DNA-specific exonuclease in T. pallidum.

CPn0563 is orthologously related to CT447, a predicted recJ single-strand DNA-specific exonuclease.
Residues 5-580 are 62% similar to CT447.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0608
COG name: Single-stranded DNA-specific exonuclease
Functional Class:  L
The phylogenetic pattern of COG0608 is AMTk-qvceB-hUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 82 to 245 (E-value = 3.9e-38) place CPn0563 in the DHH family which is described as DHH family (PF01368)
Residues 390 to 454 (E-value = 2.1e-15) place CPn0563 in the DHHA1 family which is described as DHHA1 domain (PF02272)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
311  
352

PDB Hit:


Gene Protein Sequence:
MTNSDNASAAGLLWAHPKEDPAFLGMIIKEFHLPPTVAQIFISRGFQTIQ
EIHKFLYSHLSSLYDPGLFLDMSKAVERLLLARDRKEHVMIYGDSDVDGM
TGVALLVEFLRDIDVHVSYFFLGAILKQHGETSTLIAKLKEEGITLLITV
DCGITAGKEVSDITRQGIDVIITDHHMPTGKIPHCVATLNPKLRDHTYPN
RELTGVGVAFKLARGVLNALISRNLVPKSQGSLKKLLDLVTLGTITDVGV
LLGENRVMVRYGIKEIARGARPGLNKLCALCGVEKSEVTSTDIVLKIAPK
LNSLGRLDDPAKGVELLLTQDDERVDALIMELDNINRERQRIEAEVFQDV
QEILNSNPEILKQAAIVLSSTAWHARVIPIISARLAKTYNKPVVIIAIQR
GIGKGSARTIGSFPLLGVLKKCSSLLLSYGGHDFAAGVIMKEDKVEDFKK
KFVHLVNSSLKKGDTLPHLEIDAYADFDAIDYDLLASMELFEPFGKGNLM
PIFYSKVRQVRYPKVLPGNHLKLYLSQKERNLEGVAFGLGRHADALKASW
HYPLEIAYTPRLSQTSGSGVIHLLVRDFRISSEPRFSD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAATTCAGATAATGCTTCTGCAGCAGGATTGCTCTGGGCTCATCC
CAAGGAAGATCCTGCGTTTCTTGGAATGATTATCAAAGAATTTCACTTGC
CTCCCACAGTGGCTCAGATTTTTATCTCAAGAGGATTCCAAACGATTCAG
GAAATCCATAAGTTCTTATACAGCCATCTGTCGAGCCTTTATGATCCTGG
ACTCTTCCTAGATATGTCAAAGGCTGTAGAACGCCTGCTCCTGGCTAGAG
ATCGTAAAGAACACGTCATGATTTATGGAGATAGCGATGTCGATGGCATG
ACAGGCGTCGCTCTCCTGGTCGAATTTTTAAGAGATATTGATGTCCACGT
TAGCTACTTCTTTCTTGGTGCGATACTCAAGCAACATGGAGAGACCTCCA
CACTCATTGCAAAGTTGAAAGAGGAAGGAATTACACTCCTCATCACCGTA
GATTGCGGAATTACTGCAGGAAAAGAGGTGAGTGATATTACAAGACAAGG
CATTGATGTGATCATTACAGATCACCACATGCCGACAGGAAAAATTCCCC
ACTGCGTAGCTACATTAAATCCTAAATTACGGGATCATACCTACCCGAAT
CGAGAACTCACAGGCGTAGGCGTTGCTTTTAAGCTCGCAAGAGGAGTACT
GAACGCACTGATATCCAGAAATCTTGTCCCCAAGAGTCAAGGTAGCCTGA
AAAAATTACTCGATTTAGTCACATTAGGAACCATCACGGATGTCGGTGTT
TTGCTAGGGGAAAACCGTGTTATGGTGCGCTATGGGATTAAAGAAATTGC
CAGAGGCGCGCGACCCGGATTGAATAAACTCTGCGCATTATGTGGAGTAG
AAAAAAGCGAAGTCACTTCGACAGATATTGTCTTGAAGATCGCACCAAAA
CTCAATAGCTTGGGACGGTTGGACGACCCTGCAAAAGGTGTTGAACTTTT
ACTCACCCAAGATGATGAACGTGTAGATGCTCTAATTATGGAGCTAGATA
ATATAAATAGAGAAAGGCAAAGAATAGAAGCTGAGGTATTTCAAGATGTC
CAAGAGATATTAAATAGTAATCCTGAGATTTTAAAGCAGGCTGCTATAGT
TCTTTCATCCACGGCATGGCATGCTCGTGTCATCCCTATTATCTCAGCGC
GTCTTGCTAAGACTTATAACAAACCTGTGGTAATCATCGCTATCCAACGA
GGAATTGGAAAGGGATCAGCAAGAACTATAGGGTCATTTCCTCTACTCGG
AGTCTTAAAGAAATGCTCCTCGCTCCTTTTATCTTACGGCGGACACGACT
TTGCAGCAGGCGTGATTATGAAGGAAGATAAAGTCGAAGATTTTAAAAAA
AAATTCGTTCATCTCGTGAACTCTTCTCTTAAAAAGGGTGACACACTTCC
TCATCTCGAAATTGATGCTTATGCGGATTTTGATGCTATAGATTATGATC
TCCTAGCTTCTATGGAACTATTCGAGCCTTTTGGGAAGGGGAATCTGATG
CCTATCTTCTATTCAAAAGTGCGCCAGGTACGCTATCCAAAAGTATTGCC
TGGAAACCATCTCAAACTCTACTTAAGCCAAAAAGAAAGAAATCTTGAGG
GTGTCGCCTTCGGTCTGGGAAGACACGCTGATGCATTAAAAGCAAGTTGG
CATTACCCTCTTGAGATTGCTTACACACCCCGCTTGTCCCAAACTTCTGG
ATCGGGAGTCATCCACCTGCTGGTCCGGGATTTCCGTATTTCCTCAGAAC
CTAGATTTTCAGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy