Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR450 IGR446 IGR444 IGR449 IGR447 IGR445 IGR448 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 secF,secD, - CPn0564 CPn0559 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 secF,secD, - CPn0564 CPn0559 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 secF,secD, - CPn0564 CPn0559
* Calculated from Protein Sequence

Gene ID: CPn0562

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
CHLPS 43 kDa protein homolog_1

Gene Start:
648036

Gene Stop:
646915

Gene Length:
1122

Molecular Weight*:
42249

pI*:
8.40

Net Charge*:
6.80

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
The CHLPS 43 kDa protein homologs #1-4 are respectively: CPn0562, CPn0927, CPn0928, and CPn0929.

CHLPS is a reference to the homolog found in Chlamydia psittaci.

Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST outside of sequences in C.pneumoniae; residues 12-371 are 45% similar to residues 13-371 of a hypothetical 43.0K protein from Chlamydia psittaci.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 12-371 are 47% similar to a defined domain of P94660_CHLPS, a hypothetical protein sequence.


Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae defined as being CHLPS 43 kDa protein homologs:

Residues 13-373 are 43% similar to residues 15-371 of CPn0927.
Residues 13-308 are 36% similar to residues 14-307 of CPn0929.
Residues 17-307 are 36% similar to residues 16-309 of CPn0928.

Pfam Summary:  Pfam Search
Residues 11 to 372 (E-value = 7.1e-278) place CPn0562 in the DUF818 family which is described as Chlamydia CHLPS protein (DUF818) (PF05677)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
49  
72
transmembrane  
77  
94

PDB Hit:


Gene Protein Sequence:
MSIAIAREQYAAILDMHPKPSIAMFSSEQARTSWEKRQAHPYLYRLLEII
WGVVKFLLGLIFFIPLGLFWVLQKICQNFILLGAGGWIFRPICRDSNLLR
QAYAARLFSASFQDHVSSVRRVCLQYDEVFIDGLELRLPNAKPDRWMLIS
NGNSDCLEYRTVLQGEKDWIFRIAEESQSNILIFNYPGVMKSQGNITRNN
VVKSYQACVRYLRDEPAGPQARQIVAYGYSLGASVQAEALSKEIADGSDS
VRWFVVKDRGARSTGAVAKQFIGSLGVWLANLTHWNINSEKRSKDLHCPE
LFIYGKDSQGNLIGDGLFKKETCFAAPFLDPKNLEECSGKKIPVAQTGLR
HDHILSDDVIKEVAGHIQRHFDN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAATAGCTATTGCAAGGGAACAATACGCAGCTATATTGGATATGCA
TCCTAAACCTTCGATCGCCATGTTTTCTTCGGAGCAGGCGAGAACTTCTT
GGGAGAAACGACAGGCTCATCCTTACCTTTATCGTCTTCTTGAGATCATA
TGGGGTGTTGTGAAATTTCTTCTCGGCTTAATCTTCTTTATTCCCTTGGG
TCTTTTCTGGGTCCTTCAGAAGATATGTCAGAATTTTATTCTTCTTGGTG
CAGGAGGGTGGATTTTTAGACCCATATGCAGGGACTCTAATTTATTGCGA
CAAGCTTACGCCGCGCGTCTTTTCTCCGCTTCATTCCAAGATCATGTCTC
CTCTGTGCGAAGGGTTTGCTTACAGTATGACGAGGTCTTTATTGACGGAT
TGGAGTTACGTCTTCCCAATGCTAAGCCAGATCGATGGATGTTAATCTCC
AATGGAAACTCCGATTGCTTAGAGTATAGGACAGTGCTGCAAGGGGAAAA
GGACTGGATATTCCGTATTGCTGAAGAGTCTCAATCCAACATTTTAATCT
TCAATTACCCAGGAGTCATGAAGAGCCAAGGGAATATAACAAGAAACAAT
GTAGTCAAATCTTATCAAGCATGCGTACGCTATCTTAGAGATGAACCCGC
AGGACCTCAGGCGCGTCAAATCGTTGCTTATGGCTATTCTTTAGGAGCTA
GTGTTCAAGCCGAAGCATTAAGTAAAGAGATCGCAGACGGAAGTGATAGC
GTCCGTTGGTTTGTCGTTAAAGATCGAGGAGCTCGCTCTACAGGAGCCGT
TGCTAAACAGTTTATTGGAAGTCTAGGAGTTTGGCTGGCGAATCTTACCC
ATTGGAATATTAATTCTGAAAAGAGAAGCAAGGACTTGCATTGCCCAGAA
CTCTTTATTTATGGCAAGGATTCCCAAGGTAATCTTATCGGGGATGGATT
GTTCAAAAAAGAGACGTGCTTCGCAGCACCATTTTTAGATCCTAAAAACT
TGGAAGAGTGTTCAGGGAAGAAAATCCCTGTAGCTCAGACCGGTCTAAGA
CACGATCATATCCTTTCCGATGATGTGATTAAAGAAGTTGCAGGTCATAT
TCAAAGACATTTCGATAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy