Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR450 IGR446 IGR444 IGR449 IGR447 IGR443 IGR445 IGR448 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 secF,secD, - CPn0564 CPn0559 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 secF,secD, - CPn0564 CPn0559 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 secF,secD, - CPn0564 CPn0559
* Calculated from Protein Sequence

Gene ID: CPn0561

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
euo  

Definition:
Chlamydia-specific hypothetical protein (Ygt2-related)

Gene Start:
646404

Gene Stop:
645868

Gene Length:
537

Molecular Weight*:
20667

pI*:
8.70

Net Charge*:
3.83

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0561 is orthologously related to CT446: residues 1-155 of CPn0561 are 63% similar to residues 1-158 of CT446, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MACEQHEGCYELEEREEIEDIKDSDTKWVSITQAAKLHNVTRQAIYVAIK
QKKLKASKETRWEIDIKDLEEYKRNRYSRKKSLYQGELVFDNGKGCYSIN
QVAQILGIPVQKVYYATRTGTIRGERKGAAWVIHVSEIERYKNEYLSKQA
AKKLKGAEPKEHQAPNFEPPTEIFPESN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGTGCGAACAACATGAGGGATGCTACGAATTAGAAGAAAGAGAAGA
AATTGAGGATATCAAAGACTCAGATACAAAATGGGTTTCGATCACTCAAG
CTGCTAAATTACATAACGTCACTAGGCAAGCAATTTATGTGGCAATTAAG
CAGAAAAAACTAAAAGCTTCTAAAGAGACGCGCTGGGAAATAGATATTAA
AGATTTGGAAGAGTACAAACGTAACCGTTACTCTCGAAAGAAATCTCTTT
ATCAAGGAGAGCTTGTTTTCGATAACGGTAAAGGATGCTACTCCATAAAT
CAGGTTGCTCAGATTTTAGGAATACCTGTGCAGAAGGTCTACTATGCAAC
TCGTACGGGAACCATACGAGGAGAGCGTAAGGGAGCCGCTTGGGTAATTC
ACGTATCTGAGATTGAAAGATATAAGAATGAGTATCTGAGTAAGCAAGCA
GCTAAAAAACTAAAAGGAGCTGAACCGAAAGAACATCAGGCTCCAAATTT
CGAACCTCCTACTGAAATTTTTCCTGAATCTAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy