Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR442 IGR446 IGR444 IGR449 IGR447 IGR443 IGR445 IGR448 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 CPn0559 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 CPn0559 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 CPn0559 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0560

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gltX  

Definition:
glutamyl-tRNA synthetase

Gene Start:
645612

Gene Stop:
644095

Gene Length:
1518

Molecular Weight*:
58195

pI*:
6.70

Net Charge*:
-1.87

EC:
6.1.1.17  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyllmetabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
This protein, a monomer in B.subtilis, belongs to Class I aminoacyl-tRNA synthetases.
Reaction: ATP + l-glutamate + tRNA(glu) = AMP + pyrophosphate + l-glutamyl-tRNA(glu).

Blast Summary:  PSI-Blast Search
CPn0560 is orthologously related to CT445: residues 1-503 of CPn0560 are 79% similar to residues 1-503 of CT445, a predicted glutamyl-tRNA synthetase from C. trachomatis.
CPn0560 is also similar to TP0673, MG462, UU599.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class: J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 322 (E-value = 2.7e-154) place CPn0560 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

PDB Hit:


Gene Protein Sequence:
MNWENVRVRVAPSPTGDPHVGTAYMALFNEIFAKRFKGKMILRIEDTDRT
RSRQDYEENIFSALRWCGIQWDEGPDVGGPYGPYRQSERTKIYQGYVETL
LKTDCAYKCFATPQELAEMRAVASTLGYRGGYDRRYRYLSPEEVASREAA
GQPYTIRLKVPLSGECVFEDYSKGRVVFPWADVDDQVLVKSDGFPTYHFA
NVIDDHLMGITHVLRGEEWLSSTPKHLLLYEAFGWEPPVFLHMPLLLNPD
GTKLSKRKNPTSIFYYRDSGYVKEAFVNFLTLMGYSMEGDEEVYSLERII
ETFNPRRIGKSGAVFDIQKLDWMNKHYLNHEGSPECLLKELQGWLLNDEF
FLKILPLCQSRITTLAEFINLTSFFFSGLLEYRVEELLPQALSPEKAAIL
LYSYVKYLEKTDQWTKETCYLGSKWLAQAFNVHHKKAIIPLLYVAITGKK
QGLPLFDSIEILGKPRARARLVYAEKLLGGVPKKLAATVDKFMQREDFEE
ATFDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTGGGAAAATGTCCGTGTTAGGGTAGCTCCTTCACCTACAGGAGA
TCCTCATGTAGGTACCGCCTATATGGCTCTGTTTAATGAAATCTTTGCAA
AACGATTTAAAGGGAAAATGATCCTCCGTATCGAAGATACGGATAGAACA
CGTAGTCGCCAAGATTACGAAGAAAATATTTTCTCAGCTCTTCGTTGGTG
CGGGATCCAATGGGATGAGGGCCCTGATGTAGGCGGCCCCTATGGCCCCT
ATCGTCAGTCAGAACGCACGAAAATCTATCAAGGGTATGTTGAGACACTT
TTAAAGACAGATTGCGCTTATAAGTGCTTTGCAACCCCTCAAGAACTCGC
AGAAATGCGCGCTGTGGCAAGTACCCTCGGTTATCGTGGGGGATACGATC
GCAGGTACAGGTACCTCTCTCCCGAAGAGGTAGCCTCACGAGAGGCAGCA
GGTCAGCCCTACACCATTCGTCTTAAAGTTCCCTTATCAGGGGAATGTGT
TTTCGAAGATTATAGCAAGGGAAGAGTCGTGTTTCCTTGGGCAGATGTCG
ATGATCAGGTCCTAGTAAAATCTGACGGATTCCCCACGTACCACTTTGCT
AATGTAATTGACGACCACCTCATGGGCATCACTCACGTCCTCAGAGGGGA
AGAGTGGCTAAGTTCAACTCCTAAGCATCTCCTACTCTACGAAGCTTTTG
GCTGGGAGCCTCCCGTCTTTCTCCATATGCCCCTGCTTCTAAACCCCGAT
GGAACAAAACTTTCAAAAAGAAAGAACCCTACCTCGATTTTTTATTACCG
CGACTCAGGTTATGTCAAAGAAGCCTTTGTGAACTTCCTGACTCTCATGG
GTTACAGTATGGAAGGGGATGAAGAAGTCTATTCTCTAGAGCGTATTATA
GAAACTTTTAATCCTCGACGTATTGGAAAGTCAGGAGCAGTTTTTGATAT
TCAAAAGCTCGACTGGATGAATAAGCATTACCTCAACCACGAGGGTTCGC
CAGAGTGCTTGTTAAAAGAACTCCAGGGTTGGCTACTTAATGACGAATTT
TTCTTAAAAATCCTTCCCCTCTGTCAATCTCGGATTACAACTCTTGCGGA
GTTTATCAACCTCACCTCATTCTTTTTCTCAGGATTGTTAGAGTACCGTG
TTGAGGAACTCCTACCACAGGCCCTTTCTCCAGAGAAAGCAGCTATCCTT
CTCTATAGCTATGTCAAATATCTTGAGAAAACCGATCAATGGACGAAAGA
GACGTGTTACCTCGGATCTAAATGGTTAGCTCAAGCATTCAATGTCCACC
ATAAAAAAGCCATCATCCCACTGCTTTATGTGGCAATTACTGGGAAAAAG
CAGGGGCTCCCTCTCTTTGACTCTATAGAGATTTTAGGGAAACCTCGAGC
GAGAGCACGTCTTGTGTATGCAGAAAAGCTTTTAGGAGGCGTTCCTAAGA
AGCTCGCTGCAACTGTGGATAAGTTCATGCAACGAGAAGACTTCGAAGAG
GCTACTTTCGATCTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy