Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR442 IGR446 IGR444 IGR449 IGR447 IGR443 IGR445 IGR448 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 CPn0559 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 CPn0559 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 recJ, - CPn0563 CPn0559 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0559

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
643742

Gene Stop:
643930

Gene Length:
189

Molecular Weight*:
7118

pI*:
9.60

Net Charge*:
4.31

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
No significant BLAST results but residues 5-60 of CPn0559 are 39% similar to residues 4-59 of CT444.1, a Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19

PDB Hit:


Gene Protein Sequence:
MKLFYFCNIIFLTSLFSVSCTHTPPPRSYILAQGRTPLVNKAHSLEFFLA
RSVFNTCYNTNL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTATTTTACTTTTGTAACATTATTTTCCTGACATCTCTATTTTC
TGTAAGCTGCACGCACACGCCTCCTCCACGTAGTTATATTCTTGCTCAAG
GAAGAACGCCCCTCGTCAATAAAGCGCATTCCTTAGAATTCTTTTTAGCA
AGATCTGTCTTTAACACGTGTTATAATACGAACTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy