Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR442 IGR441 IGR446 IGR444 IGR449 IGR447 IGR443 IGR445 IGR448 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 CPn0559 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 CPn0559 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 CPn0559 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0558

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
omcA  omp3  

Definition:
Chlamydia-specific hypothetical cysteine-rich outer membrane protein 9 kDa (small Crp)

Gene Start:
643300

Gene Stop:
643028

Gene Length:
273

Molecular Weight*:
9393

pI*:
7.70

Net Charge*:
2.27

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:

This protein, along with the 15 kDa and 60 kDa outer membrane components (CPn0556, CPn0557), is thought to be associated with the differentiation from the RB to the EB state. See Lambden et al., Gene 87:105 (1990).

Blast Summary:  PSI-Blast Search
CPn0558 is orthologously related to CT444: residues 1-90 of CPn0558 are 55% similar to residues 1-88 of CT444, a predicted 9 kD cysteine-rich outer membrane protein from C. trachomatis.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 12 to 67 (E-value = 3.8e-35) place CPn0558 in the Chlam_OMP3 family which is described as Chlamydia cysteine-rich outer membrane protein 3 (PF03503)

PDB Hit:


Gene Protein Sequence:
MKKAVLIAAMFCGVVSLSSCCRIVDCCFEDPCAPSSCNPCEVIRKKERSC
GGNACGSYVPSCSNPCGSTECNSQSPQVKGCTSPDGRCKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAAGCTGTTTTAATTGCTGCAATGTTTTGTGGAGTAGTTAGCTT
AAGTAGCTGCTGCCGCATTGTAGATTGTTGTTTTGAGGATCCTTGCGCAC
CCTCTTCTTGCAATCCTTGTGAAGTAATAAGAAAAAAAGAAAGATCTTGC
GGCGGTAATGCTTGTGGGTCCTACGTTCCTTCTTGTTCTAATCCATGTGG
TTCAACAGAGTGTAACTCTCAAAGCCCACAAGTTAAAGGTTGTACATCAC
CTGATGGCAGATGCAAACAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy