Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR442 IGR440 IGR441 IGR446 IGR444 IGR447 IGR443 IGR445 IGR448 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0553 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 CPn0559 CPn0554 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0553 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 CPn0559 CPn0554 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 euo, - CPn0561 CPn0556 CPn0553 CPn0562 gltX, - CPn0560 omp2,omcB, - CPn0557 CPn0559 CPn0554 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0557

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
omp2  omcB  

Definition:
Chlamydia-specific cysteine-rich hypothetical outer membrane protein 60 kDa

Gene Start:
642861

Gene Stop:
641191

Gene Length:
1671

Molecular Weight*:
59709

pI*:
6.20

Net Charge*:
-4.13

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
Chlamydia-specific cysteine-rich hypothetical outer membrane protein 60 kDa.
See de la Maza et al., Infect.Immun. 59:1196 (1991); Watson et al., FEMS Microbiol. Lett. 53:293 (1989); Allen et al., Mol. Microbiol. 4:1543 (1989).
This protein and the 15 kDa protein (CPn0556) are thought to be associated with the change from the RB to the EB state and with the composition of the EB outer envelope. See CPn0558 for the 9 kDa component sequence.

Blast Summary:  PSI-Blast Search
CPn0557 is orthologously related to CT443: residues 1-556 of CPn0557 are 71% similar to residues 7-553 of CT443, a predicted Chlamydia-specific cysteine-rich outer membrane protein 60 kDa from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 97 to 191 (E-value = 2.7e-74) place CPn0557 in the Chlam_OMP6 family which is described as Chlamydia cysteine-rich outer membrane protein 6 (PF03504)
Residues 198 to 269 (E-value = 2.1e-15) place CPn0557 in the DUF11 family which is described as Domain of unknown function DUF11 (PF01345)
Residues 300 to 375 (E-value = 1.6e-18) place CPn0557 in the DUF11 family which is described as Domain of unknown function DUF11 (PF01345)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
28

PDB Hit:


Gene Protein Sequence:
MSKLIRRVVTVLALTSMASCFASGGIEAAVAESLITKIVASAETKPAPVP
MTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGR
LYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLP
CEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGCCFTA
ATVCACPELRSYTKCGQPAICIKQEGPDCACLRCPVCYKIEVVNTGSAIA
RNVTVDNPVPDGYSHASGQRVLSFNLGDMRPGDKKVFTVEFCPQRRGQIT
NVATVTYCGGHKCSANVTTVVNEPCVQVNISGADWSYVCKPVEYSISVSN
PGDLVLHDVVIQDTLPSGVTVLEAPGGEICCNKVVWRIKEMCPGETLQFK
LVVKAQVPGRFTNQVAVTSESNCGTCTSCAETTTHWKGLAATHMCVLDTN
DPICVGENTVYRICVTNRGSAEDTNVSLILKFSKELQPIASSGPTKGTIS
GNTVVFDALPKLGSKESVEFSVTLKGIAPGDARGEAILSSDTLTSPVSDT
ENTHVY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCAAACTCATCAGACGAGTAGTTACGGTCCTTGCGCTAACGAGTAT
GGCGAGTTGCTTTGCCAGCGGGGGTATAGAGGCCGCTGTAGCAGAGTCTC
TGATTACTAAGATCGTCGCTAGTGCGGAAACAAAGCCAGCACCTGTTCCT
ATGACAGCGAAGAAGGTTAGACTTGTCCGTAGAAATAAACAACCAGTTGA
ACAAAAAAGCCGTGGTGCTTTTTGTGATAAAGAATTTTATCCCTGTGAAG
AGGGACGATGTCAACCTGTAGAGGCTCAGCAAGAGTCTTGCTACGGAAGA
TTGTATTCTGTAAAAGTAAACGATGATTGCAACGTAGAAATTTGCCAGTC
CGTTCCAGAATACGCTACTGTAGGATCTCCTTACCCTATTGAAATCCTTG
CTATAGGCAAAAAAGATTGTGTTGATGTTGTGATTACACAACAGCTACCT
TGCGAAGCTGAATTCGTAAGCAGTGATCCAGAAACAACTCCTACAAGTGA
TGGGAAATTAGTCTGGAAAATCGATCGCCTGGGTGCAGGAGATAAATGCA
AAATTACTGTATGGGTAAAACCTCTTAAAGAAGGTTGCTGCTTCACAGCT
GCTACTGTATGTGCTTGCCCAGAGCTCCGTTCTTATACTAAATGCGGTCA
ACCAGCCATTTGTATTAAGCAAGAAGGACCTGACTGTGCTTGCCTAAGAT
GCCCTGTATGCTACAAAATCGAAGTAGTGAACACAGGATCTGCTATTGCC
CGTAACGTAACTGTAGATAATCCTGTTCCCGATGGCTATTCTCATGCATC
TGGTCAAAGAGTTCTCTCTTTTAACTTAGGAGACATGAGACCTGGCGATA
AAAAGGTATTTACAGTTGAGTTCTGCCCTCAAAGAAGAGGTCAAATCACT
AACGTTGCTACTGTAACTTACTGCGGTGGACACAAATGTTCTGCAAATGT
AACTACAGTTGTTAATGAGCCTTGTGTACAAGTAAATATCTCTGGTGCTG
ATTGGTCTTACGTATGTAAACCTGTGGAGTACTCTATCTCAGTATCGAAT
CCTGGAGACTTGGTTCTTCATGATGTCGTGATCCAAGATACACTCCCTTC
TGGTGTTACAGTACTCGAAGCTCCTGGTGGAGAGATCTGCTGTAATAAAG
TTGTTTGGCGTATTAAAGAAATGTGCCCAGGAGAAACCCTCCAGTTTAAA
CTTGTAGTGAAAGCTCAAGTTCCTGGAAGATTCACAAATCAAGTTGCAGT
AACTAGTGAGTCTAACTGCGGAACATGTACATCTTGCGCAGAAACAACAA
CACATTGGAAAGGTCTTGCAGCTACCCATATGTGCGTATTAGACACAAAT
GATCCTATCTGTGTAGGAGAAAATACTGTCTATCGTATCTGTGTAACTAA
CCGTGGTTCTGCTGAAGATACTAACGTATCTTTAATCTTGAAGTTCTCAA
AAGAACTTCAGCCAATAGCTTCTTCAGGTCCAACTAAAGGAACGATTTCA
GGTAATACCGTTGTTTTCGACGCTTTACCTAAACTCGGTTCTAAGGAATC
TGTAGAGTTTTCTGTTACCTTGAAAGGTATTGCTCCCGGAGATGCTCGCG
GCGAAGCTATTCTTTCTTCTGATACACTGACTTCACCAGTATCAGACACA
GAAAATACCCACGTGTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy