Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR437 IGR438 IGR442 IGR440 IGR441 IGR446 IGR444 IGR439 IGR447 IGR443 IGR445 omcA,omp3, - CPn0558 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 gltX, - CPn0560 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0559 CPn0554 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 gltX, - CPn0560 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0559 CPn0554 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 rs12, - CPn0552 CPn0556 CPn0553 gltX, - CPn0560 omp2,omcB, - CPn0557 fusA, - CPn0550 rs7, - CPn0551 CPn0559 CPn0554 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0556

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical cysteine-rich 15 kD outer membrane protein

Gene Start:
640912

Gene Stop:
640322

Gene Length:
591

Molecular Weight*:
20642

pI*:
7.80

Net Charge*:
1.52

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical cysteine-rich 15 kD outer membrane protein.
This protein and the 60 kDa protein (CPn0557) are thought to be associated with the
change from the RB to the EB state and with the composition of the EB outer
envelope. See CPn0558 for the 9 kDa component sequence.

Blast Summary:  PSI-Blast Search
CPn0556 is similar to a hypothetical sulfur-rich protein from Chlamydia psittaci (accession U41759): residues 47-160 of CPn0556 are 50% similar to residues 33-146 of the protein from C. psittaci.
CPn0556 is also similar to a hypothetical sulfur-rich protein from Chlamydia psittaci (accession M61116/P28164) residues 34-133 of CPn0556 are 48% similar to residues 17-120 of M61116/P28164.
No significant similarity to C. trachomatis, T. pallidum, U. urealyticum, M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 160 (E-value = 3.6e-118) place CPn0556 in the CRPA family which is described as Chlamydia 15 kDa cysteine-rich outer membrane protein (CRPA) (PF05745)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
54
transmembrane  
79  
100
transmembrane  
105  
122

PDB Hit:


Gene Protein Sequence:
MSSNLHPVGGTGTGAAAPESVLNIVEEIAASGSVTAGLQAITSSPGMVNL
LIGWAKTKFIQPIRESKLFQSRACQITLLVLGILLVVAGLACMFIFHSQL
GANAFWLIIPAAIGLIKLLVTSLCFDEACTSEKLMVFQKWAGVLEDQLDD
GILNNSNKIFGHVKTEGNTSRATTPVLNDGRGTPVLSPLVSKIARV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATCAAATCTACATCCCGTAGGAGGAACAGGAACAGGAGCAGCTGC
TCCTGAGTCTGTGCTAAACATAGTAGAGGAAATAGCAGCATCGGGGAGTG
TCACCGCTGGTCTACAAGCAATTACGTCCAGTCCAGGAATGGTGAATCTA
CTCATAGGATGGGCAAAGACAAAATTTATTCAACCTATACGTGAATCAAA
GCTCTTTCAATCCAGAGCTTGCCAAATTACCCTGCTCGTTTTAGGAATTC
TTTTGGTTGTTGCTGGATTAGCATGTATGTTTATCTTCCATAGCCAGTTA
GGGGCAAATGCATTTTGGTTGATTATTCCTGCTGCCATAGGATTGATTAA
GTTACTAGTTACATCATTATGTTTTGATGAAGCTTGTACATCTGAAAAAC
TCATGGTTTTCCAAAAATGGGCAGGTGTTTTAGAAGATCAGCTCGATGAT
GGGATCCTTAATAACTCAAATAAGATTTTTGGCCATGTGAAAACAGAAGG
AAATACCTCTAGGGCTACTACCCCAGTACTTAATGATGGCCGCGGAACTC
CTGTACTTTCACCTTTAGTAAGTAAAATAGCTCGCGTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy