Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR437 IGR438 IGR442 IGR440 IGR441 IGR446 IGR444 IGR439 IGR443 IGR445 omcA,omp3, - CPn0558 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 gltX, - CPn0560 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0559 CPn0554 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 gltX, - CPn0560 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0559 CPn0554 tsp,prc, - CPn0555 omcA,omp3, - CPn0558 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 gltX, - CPn0560 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0559 CPn0554 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0555

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tsp  prc  

Definition:
probable tail-specific protease

Gene Start:
638298

Gene Stop:
640244

Gene Length:
1947

Molecular Weight*:
73153

pI*:
6.60

Net Charge*:
-4.27

EC:
3.4.21.-  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Secondary Evidence:
Keiler, K.C., K.R. Silber, K.M. Downard, I.A. Papayannopoulos, K. Biemann, R.T. Sauer 1995. "C-terminal specific protein degradation: activity and substrate specificity of the Tsp protease." Protein Sci. 4:1507-1515.
Silber, K.R., K.C. Keiler, R.T. Sauer 1992. "Tsp: a tail-specific protease that selectively degrades proteins with nonpolar C termini." Proc.Natl.Acad.Sci.USA 89:295-299.


Comment:
This peptidase appears to selectively degrade proteins with nonpolar C-termini,
e.g., penicillin-binding protein 3.

In E. coli, Prc is suggested to be part of the fatty acid transport system (Azizan, A. and P.N. Black, 1994).
It also appears to be a membrane protein situated on the periplasmic side of the cytoplasmic membrane.

Blast Summary:  PSI-Blast Search
CPn0555 is orthlogously related to CT441: residues 4-644 of CPn0555 are 66% similar to residues 1-641 of CT441, a probable tail-specific protease from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0793
COG name: Periplasmic protease
Functional Class:  M
The phylogenetic pattern of COG0793 is -----qvCeB-huj--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 247 to 324 (E-value = 1.1e-09) place CPn0555 in the PDZ family which is described as PDZ domain (Also known as DHR or GLGF) (PF00595)
Residues 356 to 530 (E-value = 2.9e-39) place CPn0555 in the Peptidase_S41 family which is described as Peptidase family S41B (PF03572)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
113  
191
non-globular  
256  
364

PDB Hit:


Gene Protein Sequence:
MFVMKKLVRLCVVLLSLLPNVLFSSDLLREEGIKKMMDKLIEYHVDAQEV
STDILSRSLSSYIQSFDPHKSYLSNQEVAVFLQSPETKKRLLKNYKAGNF
AIYRNINQLIHESILRARQWRNEWVKNPKELVLEASSYQISKQPMQWSKS
LDEVKQRQRALLLSYLSLHLAGASSSRYEGKEEQLAALCLRQIENHENVY
LGINDHGVAMDRDEEAYQFHIRVVKALAHSLDAHTAYFSKDEALAMRIQL
EKGMCGIGVVLKEDIDGVVVREIIPGGPAAKSGDLQLGDIIYRVDGKDIE
HLSFRGVLDCLRGGHGSTVVLDIHRGESDHTIALRREKILLEDRRVDVSY
EPYGDGVIGKVTLHSFYEGENQVSSEQDLRRAIQGLKEKNLLGLVLDIRE
NTGGFLSQAIKVSGLFMTNGVVVVSRYADGTMKCYRTVSPKKFYDGPLAI
LVSKSSASAAEIVAQTLQDYGVALVVGDEQTYGKGTIQHQTITGDASQDD
CFKVTVGKYYSPSGKSTQLQGVKSDILIPSLYAEDRLGERFLEHPLPADC
CDNVLHDPLTDLDTQTRPWFQKYYLPNLQKQETLWREMLPQLTKNSEQRL
SENSNFQAFLSQIKSSEKTDLSYGSNDLQLEESINILKDMILLQQCRK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCGTAATGAAAAAACTTGTCCGTCTATGCGTAGTTCTTCTTTCTTT
ACTTCCGAATGTATTATTTTCTTCGGATCTTTTACGAGAAGAGGGCATCA
AAAAGATGATGGACAAGCTGATCGAGTATCATGTCGATGCTCAAGAGGTT
TCTACGGATATACTCTCGCGTTCTTTATCTAGTTACATTCAATCTTTTGA
TCCTCATAAATCTTATCTTTCAAACCAAGAGGTTGCAGTTTTTCTACAGT
CTCCGGAAACAAAGAAACGTCTCTTAAAGAATTATAAGGCAGGCAACTTT
GCTATTTATCGCAACATCAATCAATTAATTCATGAGAGTATTCTTCGTGC
CAGGCAGTGGAGAAACGAATGGGTTAAGAATCCAAAAGAGCTTGTATTGG
AGGCATCCTCATATCAGATATCGAAGCAACCTATGCAATGGAGCAAATCT
TTAGACGAAGTGAAGCAGAGACAACGCGCTCTACTCCTTTCCTATCTTTC
TTTACATCTTGCTGGAGCTTCTTCCTCTCGTTATGAGGGTAAAGAAGAGC
AGCTTGCTGCTCTGTGTCTACGTCAAATCGAGAACCATGAGAATGTATAT
TTAGGTATCAACGATCATGGTGTTGCTATGGATCGGGATGAAGAAGCCTA
CCAATTCCATATCCGTGTTGTTAAAGCTTTAGCTCATAGCTTAGATGCAC
ATACGGCGTATTTCAGTAAGGACGAAGCGTTGGCGATGCGAATCCAACTA
GAAAAAGGCATGTGTGGAATTGGTGTTGTTCTGAAGGAAGATATTGATGG
AGTTGTTGTTAGAGAAATCATTCCTGGGGGACCTGCGGCTAAATCTGGGG
ATCTTCAGCTTGGAGATATCATCTATCGGGTGGATGGCAAGGATATCGAG
CATCTTTCTTTCCGCGGTGTTTTAGATTGTTTACGTGGAGGTCATGGCTC
TACTGTAGTCTTAGATATCCATCGTGGGGAGAGCGATCATACGATCGCCT
TGAGAAGGGAGAAAATCCTTTTAGAAGACCGTCGTGTGGATGTTTCCTAT
GAGCCTTATGGAGATGGTGTGATTGGGAAAGTTACGTTACATTCTTTTTA
TGAAGGAGAAAATCAGGTTTCTAGTGAACAAGATCTACGTCGAGCGATTC
AGGGATTAAAGGAGAAGAACCTTCTTGGATTAGTTTTAGATATCCGAGAA
AATACGGGTGGATTTTTATCTCAAGCGATCAAAGTTTCTGGTTTATTTAT
GACCAATGGCGTTGTGGTTGTATCTCGCTATGCTGATGGTACCATGAAGT
GCTACCGCACAGTATCTCCTAAAAAATTCTATGATGGTCCTTTGGCTATT
TTAGTATCTAAAAGTTCCGCATCAGCAGCGGAGATTGTAGCACAAACTCT
CCAAGATTATGGAGTTGCTTTAGTTGTTGGAGATGAGCAGACCTATGGGA
AGGGAACGATTCAGCATCAAACAATTACTGGAGATGCCTCTCAGGACGAT
TGTTTTAAGGTTACTGTAGGGAAATATTATTCCCCTTCTGGGAAATCGAC
TCAACTTCAGGGAGTAAAATCCGATATTTTAATTCCTTCTCTCTATGCTG
AAGATCGTCTAGGAGAGCGTTTTCTAGAGCATCCCTTACCTGCAGATTGC
TGTGATAATGTACTTCACGATCCTCTCACGGACTTGGATACTCAAACACG
TCCTTGGTTTCAAAAATACTATCTTCCTAATCTACAAAAGCAAGAGACTC
TTTGGAGAGAGATGCTACCTCAGCTTACGAAAAACAGTGAGCAAAGGCTT
TCTGAGAATTCGAATTTTCAGGCATTTTTGTCGCAGATAAAATCATCTGA
AAAAACGGACCTATCCTATGGTTCCAATGATTTACAATTGGAAGAGTCGA
TAAACATTTTGAAGGACATGATTTTATTACAACAGTGTAGAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy