Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR436 IGR435 IGR437 IGR438 IGR442 IGR440 IGR441 IGR444 IGR439 IGR443 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 tsp,prc, - CPn0555 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 tsp,prc, - CPn0555 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 rs10, - CPn0549 CPn0554 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0554

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
637854

Gene Stop:
638144

Gene Length:
291

Molecular Weight*:
10510

pI*:
8.70

Net Charge*:
2.12

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:
Chlamydia pneumoniae-specific protein.

Blast Summary:  PSI-Blast Search
No significant BLAST hits.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
55
transmembrane  
60  
83

PDB Hit:


Gene Protein Sequence:
MYEGKSRMASPTPGQLHLQQKVESKAYDYSRSLAMIATALLFFIVALILS
GLSLLPQVFLPFSGAYFIIGSFLAFIALGILLINCVCDLKQYLTSS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACGAAGGAAAATCACGCATGGCATCGCCCACTCCAGGACAATTGCA
TCTACAGCAAAAAGTAGAATCAAAGGCCTATGACTATTCACGCAGCCTCG
CTATGATTGCTACAGCTTTGTTATTTTTTATTGTTGCTCTTATTCTTTCT
GGATTGAGTCTGCTTCCTCAGGTCTTCCTCCCCTTTTCAGGAGCGTATTT
TATTATCGGTTCTTTTTTAGCTTTTATTGCGTTAGGGATTCTTCTTATTA
ATTGCGTCTGCGATCTCAAACAGTACCTTACCTCGTCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy