Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR436 IGR435 IGR437 IGR438 IGR442 IGR440 IGR441 IGR439 IGR443 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 tsp,prc, - CPn0555 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 tsp,prc, - CPn0555 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0553

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
637747

Gene Stop:
636809

Gene Length:
939

Molecular Weight*:
35159

pI*:
5.20

Net Charge*:
-6.45

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant simiarity to any other knwon sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MWRVVLRFLIIFILGRAVFPLRASESFSWETSTCLTVLGIPFIDIILTTN
EDFVAQCGLQIGTISSTNNAKIKEIFLIYKEKFPEASISFKRKEPLNLSQ
SHLSDLGILCMRNGETYAEGMANKENGPALKQPKDLRLVLRCPNQPDTLL
YSEKEAEKGIETNTCLCNQGYTLLDGQLILYGDSIEKFLKETKRKNNHTL
VDLCDSQVVTTFLGRFWSLLNYVQVLFLSEDSAKILAGIPDLAQATQLLS
HTVPLLFIYTNDSIHIIEQGKESSFTYNQDLTEPILGFLFGYINRGSMEY
CFNCAQSSLGET$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGCGCGTTGTCCTCAGATTCCTTATAATTTTTATCTTGGGAAGAGC
CGTCTTCCCTCTAAGAGCTTCAGAAAGCTTCTCCTGGGAAACATCGACCT
GTTTAACAGTGCTAGGGATTCCTTTCATAGATATTATCCTCACAACGAAT
GAGGACTTTGTTGCCCAGTGCGGCCTGCAAATAGGAACCATTTCTTCGAC
TAATAACGCAAAAATAAAAGAAATTTTTTTGATATATAAGGAAAAATTTC
CAGAAGCCTCTATCAGTTTCAAACGAAAAGAACCTCTAAACCTTTCCCAA
TCCCATCTCTCCGATTTAGGTATTTTATGTATGCGTAACGGAGAAACTTA
CGCTGAGGGAATGGCAAATAAAGAAAACGGACCCGCTCTAAAACAACCCA
AGGATCTAAGATTAGTTTTACGTTGTCCTAACCAACCAGATACCCTGCTC
TACTCGGAAAAAGAAGCAGAAAAGGGCATAGAAACAAATACTTGCCTATG
CAATCAGGGATACACACTCCTGGATGGGCAATTGATTCTCTACGGGGATA
GTATAGAAAAGTTTCTGAAAGAGACCAAAAGAAAGAATAACCACACGCTT
GTTGATCTTTGTGACTCACAAGTCGTGACCACGTTCCTCGGTCGCTTTTG
GTCTCTTCTAAACTACGTTCAAGTTCTTTTCCTATCTGAAGACTCCGCTA
AAATTCTTGCGGGCATCCCAGACCTAGCTCAAGCTACGCAATTGCTTTCC
CACACCGTACCTTTGCTTTTTATTTATACCAACGATTCTATTCACATCAT
AGAACAAGGCAAAGAAAGTAGTTTTACCTATAACCAAGATTTAACAGAGC
CCATTTTAGGATTTCTCTTTGGTTACATAAATCGCGGCTCTATGGAATAC
TGCTTTAATTGTGCACAGTCTTCATTAGGAGAAACCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy