Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 IGR436 IGR435 IGR437 IGR438 IGR442 IGR440 IGR441 IGR439 IGR443 IGR434 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555 rs10, - CPn0549 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 omp2,omcB, - CPn0557 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0552

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs12  

Definition:
30S ribosomal protein S12

Gene Start:
636587

Gene Stop:
636216

Gene Length:
372

Molecular Weight*:
13815

pI*:
12.00

Net Charge*:
25.56

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0552 is similar to TP0243 in T. pallidum, UU525
in U. urealyticum and MG087 in M. genitalium.

CPn0552 is orthologously related to CT439:
Residues 1-123 are 93% similar to that of CT439.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0048
COG name: Ribosomal protein S12
Functional Class:  J
The phylogenetic pattern of COG0048 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. Pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 123 (E-value = 4.1e-72) place CPn0552 in the Ribosomal_S12 family which is described as Ribosomal protein S12 (PF00164)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
61

PDB Hit:


Gene Protein Sequence:
MPTINQLIRKRRKSSLARKKSPALQKCPQKRGVCLQVKTKTPKKPNSALR
KVAWVRLSNGQEVIAYIGGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRG
TLDCAAVKNRKQSRSRYGAKRPK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCACCATTAATCAATTAATACGTAAAAGACGTAAGTCAAGTCTAGC
TAGAAAGAAATCCCCAGCTTTGCAGAAGTGCCCACAAAAGCGGGGAGTTT
GCCTTCAAGTAAAAACAAAAACTCCTAAGAAGCCGAACTCGGCTTTAAGG
AAAGTTGCTTGGGTGCGACTATCTAACGGGCAGGAAGTCATTGCCTATAT
TGGTGGTGAAGGACACAATCTTCAAGAGCACAGCATTGTGTTGATCCAAG
GCGGTAGAGTCAAAGATTTGCCTGGTGTTCGTTATCATATTGTTCGTGGC
ACCCTAGATTGTGCAGCAGTAAAAAATAGAAAGCAAAGTCGTTCACGGTA
CGGCGCAAAGCGGCCTAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy