Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 IGR436 IGR435 IGR437 IGR438 IGR442 IGR440 IGR441 IGR439 IGR443 IGR434 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0556 CPn0553 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0551

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs7  

Definition:
30S ribosomal protein S7

Gene Start:
636168

Gene Stop:
635695

Gene Length:
474

Molecular Weight*:
17824

pI*:
10.70

Net Charge*:
13.10

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0551 is similar to TP0244 in T. pallidum, UU524
in U. urealyticum and MG088 in M. genitalium.

CPn0551 is orthologously related to CT438:
residues 1-157 are 87% similar to that of CT438.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0049
COG name: Ribosomal protein S7
Functional Class:  J
The phylogenetic pattern of COG0049 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 150 (E-value = 1.4e-87) place CPn0551 in the Ribosomal_S7 family which is described as Ribosomal protein S7p/S5e (PF00177)

PDB Hit:


Gene Protein Sequence:
MSRRHSAEKRDIPGDPIYGSVILEKFINKVMMHGKKSVARKIVYSALERF
GKKLNLENVLEGFGEALENAKPILEVRSRRVGGATYQVPVEVASERRNCL
AMQWIIKHARSKPGKSMEVGLATELIDCFNKQGATIKKREDTHRMAEANK
AFAHYKW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAGGCGGCACTCCGCTGAAAAGCGCGATATCCCTGGGGATCCTAT
CTATGGCAGCGTGATCTTAGAAAAATTTATCAACAAGGTTATGATGCATG
GGAAGAAAAGTGTGGCAAGGAAAATTGTCTACTCTGCTCTAGAGCGTTTC
GGTAAAAAATTAAATTTAGAGAATGTGCTTGAAGGTTTTGGAGAAGCTTT
AGAAAATGCAAAACCTATTTTAGAAGTTCGTTCCCGTCGTGTTGGAGGCG
CTACTTATCAAGTGCCTGTTGAAGTTGCTAGCGAACGTAGGAATTGTTTA
GCGATGCAATGGATCATCAAACACGCTCGTAGTAAACCTGGAAAGTCTAT
GGAAGTTGGACTTGCTACCGAACTGATTGACTGCTTCAACAAACAGGGTG
CAACAATTAAGAAACGTGAAGACACCCATCGTATGGCGGAAGCAAATAAA
GCATTCGCACATTATAAGTGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy