Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 IGR436 IGR435 IGR433 IGR437 IGR438 IGR432 IGR440 IGR441 IGR439 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 tsp,prc, - CPn0555 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0554 CPn0547 tsp,prc, - CPn0555
* Calculated from Protein Sequence

Gene ID: CPn0550

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fusA  

Definition:
elongation factor G protein

Gene Start:
635661

Gene Stop:
633577

Gene Length:
2085

Molecular Weight*:
76581

pI*:
5.10

Net Charge*:
-18.63

EC:
 

Functional Class:

Pathway: pathway table

Comment:
Elongation factor G (EF-G) promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome.
A cytoplasmically-located protein belonging to the EF-G/EF-2 family.



Blast Summary:  PSI-Blast Search
CPn0550 is orthologously related to CT437: residues 1-694 of CPn0550 are 92% similar to residues 1-694 of CT437, a predicted elongation factor G protein from C. trachomatis.
CPn0550 is also similar to UU523, MG089, TP0767, TP0450, UU324, TP0510, CT064, MG138.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0480
COG name: Translation elongation and release factors (GTPases)
Functional Class:  J
The phylogenetic pattern of COG0480 is amtkYqVCEbRHujgpOLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0550 is paralogously related to CPn0359: residues 4-157 of CPn0550 are 36% similar to residues 2-156 of CPn0359, a predicted GTPase from C. pneumoniae.


Pfam Summary:  Pfam Search
Residues 9 to 288 (E-value = 5.9e-106) place CPn0550 in the GTP_EFTU family which is described as Elongation factor Tu GTP binding domain (PF00009)
Residues 328 to 395 (E-value = 1.4e-18) place CPn0550 in the GTP_EFTU_D2 family which is described as Elongation factor Tu domain 2 (PF03144)
Residues 483 to 602 (E-value = 1.7e-64) place CPn0550 in the EFG_IV family which is described as Elongation factor G, domain IV (PF03764)
Residues 604 to 691 (E-value = 2.3e-42) place CPn0550 in the EFG_C family which is described as Elongation factor G C-terminus (PF00679)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
202  
233
non-globular  
485  
590

PDB Hit:


Gene Protein Sequence:
MSNQEFDLSAIRNIGIMAHIDAGKTTTTERILFYAGRTHKIGEVHEGGAT
MDWMAQEQERGITITSAATTVFWLGAKINIIDTPGHVDFTIEVERSLRVL
DGAVAVFDAVSGVEPQSETVWRQADKYGVPRIAFVNKMDRMGADYFAAVE
SMKEKLGANAFPVHCPIGSESQFVGMVDLISQKALYFLDDTLGAKWEEKE
ISEDLKERCAELRANLLEELATIDESNEAFMMKVLEDPDSITEDEIHQVM
RKGVIENKINPVLCGTAFKNKGVQQLLNVIVKWLPSPLDRGNIRGINLKT
DQEISLEPRRDGPLAALAFKIMTDPYVGRITFIRIYSGTLKKGSAILNST
KDKKERISRLLEMHANERTDRDEFTVGDIGACVGLKFSVTGDTLCDDNQE
IVLERIEFPDPVIDMAIEPKSKGDREKLAQALSSLSEEDPTFRVSTNEET
GQTIISGMGELHLDILRDRMIREFKVEANVGKPQVSYKETITVSGNSETK
YVKQSGGRGQYAHVCLEIEPNEPGKGNEVVSKIVGGVIPKEYIPAVIKGI
EEGLNTGVLAGYGLVDVKVSIVFGSYHEVDSSEMAFKICGSMAVKDACRK
AKPVILEPIMKVAVITPEDHLGDVIGDLNRRRGKILGQESSRGMAQVNAE
VPLSEMFGYTTSLRSLTSGRATSTMEPAFFAKVPQKIQEEIVKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAATCAAGAATTCGATTTAAGTGCAATTAGAAACATCGGCATCAT
GGCTCATATTGATGCTGGGAAAACAACGACTACAGAAAGAATTCTTTTCT
ATGCTGGAAGAACTCACAAAATCGGTGAAGTTCATGAAGGCGGAGCTACC
ATGGACTGGATGGCCCAGGAGCAAGAAAGAGGAATTACGATTACCTCTGC
TGCAACTACTGTCTTCTGGCTAGGCGCAAAAATCAACATTATTGATACTC
CTGGACACGTCGACTTTACGATTGAAGTAGAACGTTCTCTTCGGGTTCTT
GATGGTGCTGTAGCCGTATTTGACGCCGTATCTGGCGTGGAACCTCAATC
AGAAACTGTTTGGAGACAAGCAGATAAATACGGTGTTCCACGGATTGCTT
TCGTAAATAAAATGGACCGTATGGGAGCAGACTATTTTGCTGCCGTGGAA
TCCATGAAAGAGAAATTGGGAGCGAATGCTTTCCCTGTCCACTGTCCTAT
TGGATCTGAAAGCCAGTTTGTCGGCATGGTCGATCTAATCTCTCAAAAAG
CTCTTTATTTTCTAGATGATACCCTAGGAGCAAAATGGGAAGAAAAAGAG
ATTTCTGAAGATCTCAAAGAGCGTTGTGCAGAATTGCGAGCGAATCTTTT
GGAAGAACTCGCTACTATAGATGAAAGTAATGAAGCTTTCATGATGAAAG
TTCTTGAAGATCCCGATAGCATTACTGAAGATGAAATCCATCAGGTTATG
CGTAAGGGAGTCATTGAGAATAAAATCAATCCTGTACTCTGCGGAACCGC
TTTTAAAAATAAAGGTGTGCAACAACTGCTCAATGTGATTGTCAAGTGGT
TGCCTTCTCCTTTGGATCGAGGAAATATCCGCGGAATCAATCTTAAAACA
GATCAAGAAATTAGTTTAGAGCCAAGACGTGATGGACCTCTAGCAGCTCT
AGCTTTCAAAATCATGACAGATCCCTACGTAGGTCGGATTACATTTATCC
GAATCTATTCAGGCACTCTTAAAAAAGGGTCTGCCATTTTAAATTCTACA
AAAGATAAAAAAGAACGGATTTCTCGCCTTTTAGAAATGCACGCTAATGA
GCGTACAGATAGAGATGAGTTTACTGTGGGCGATATTGGAGCTTGCGTGG
GTCTGAAGTTTTCTGTCACAGGAGATACCTTGTGTGACGATAACCAAGAA
ATTGTTCTTGAACGTATAGAATTTCCAGACCCCGTCATCGATATGGCTAT
TGAGCCAAAGTCTAAAGGGGATAGAGAAAAACTTGCTCAAGCATTAAGTT
CTTTATCAGAAGAAGATCCTACATTCCGTGTCTCAACAAATGAAGAGACA
GGACAGACCATCATTTCTGGAATGGGGGAACTTCATTTAGATATTCTTCG
AGATCGTATGATCCGAGAATTTAAAGTTGAAGCTAACGTAGGAAAACCGC
AAGTTTCTTATAAAGAAACCATTACTGTGAGCGGAAATAGTGAAACAAAA
TACGTGAAGCAGTCTGGTGGTCGAGGGCAATATGCTCACGTTTGCCTCGA
AATAGAACCTAACGAACCTGGGAAAGGCAACGAAGTTGTCAGTAAGATTG
TCGGAGGTGTCATTCCTAAAGAATATATCCCTGCAGTAATTAAAGGGATA
GAAGAGGGATTGAACACAGGAGTCCTGGCTGGCTACGGTCTTGTAGACGT
TAAGGTAAGTATTGTTTTCGGTTCGTATCACGAAGTCGATTCTAGTGAAA
TGGCATTTAAGATCTGTGGGTCTATGGCAGTTAAAGACGCCTGTAGAAAA
GCGAAGCCCGTAATCTTAGAGCCAATCATGAAGGTAGCAGTAATTACCCC
AGAAGATCATCTTGGCGATGTTATTGGGGACCTCAACCGTCGTCGAGGCA
AAATTTTAGGACAAGAATCTTCTCGAGGAATGGCTCAAGTGAATGCTGAG
GTACCTCTAAGCGAAATGTTTGGGTACACGACATCTTTAAGATCATTGAC
CTCAGGACGTGCAACATCAACCATGGAACCAGCATTCTTTGCTAAGGTTC
CTCAAAAAATTCAAGAAGAGATTGTTAAGAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy