Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 IGR436 IGR435 IGR433 IGR437 IGR438 IGR432 IGR440 IGR441 IGR439 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 CPn0543 tsp,prc, - CPn0555 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0554 CPn0547 CPn0543 tsp,prc, - CPn0555 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0547 CPn0543 tsp,prc, - CPn0555 CPn0542 CPn0542 CPn0554
* Calculated from Protein Sequence

Gene ID: CPn0549

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs10  

Definition:
30S ribosomal protein S10

Gene Start:
633569

Gene Stop:
633252

Gene Length:
318

Molecular Weight*:
11823

pI*:
11.10

Net Charge*:
11.47

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0549 is similar to TP0188 in T. pallidum, UU230 in U. urealyticum and MG150 in M. genitalium.

CPn0549 is orthologously related to CT436:
residues 1-105 are 95% similar to that of CT436.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0051
COG name: Ribosomal protein S10
Functional Class:  J
The phylogenetic pattern of COG0051 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 102 (E-value = 2.6e-56) place CPn0549 in the Ribosomal_S10 family which is described as Ribosomal protein S10p/S20e (PF00338)

PDB Hit:


Gene Protein Sequence:
MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVVGPIPLPTKREV
YTVLRSPHVDKKSREQFEIRTHKRLVDILDPTGKTIDALKMLALPAGVDI
KIKAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCAGCAAAAGCAAAAAATTCGTATTCGTCTGAAAGGATTCGATCA
GGGGCAGCTAGATCGTTCCACAGCAGATATTGTTGAAACTGCTAAAAGAA
CAGGAGCTCGTGTTGTAGGACCAATTCCTCTGCCTACAAAAAGAGAAGTC
TATACTGTATTGCGTTCGCCACATGTGGATAAAAAATCAAGAGAGCAGTT
TGAAATTCGTACTCACAAACGTCTTGTAGATATTTTAGATCCCACAGGAA
AAACTATCGATGCTTTGAAAATGTTAGCACTTCCTGCAGGAGTTGATATT
AAAATCAAAGCGGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy