Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 IGR436 IGR435 IGR433 IGR437 IGR438 IGR432 IGR439 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0547 CPn0543 CPn0542 yebL, - CPn0541 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0548

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cysJ  

Definition:
probable sulfite reductase

Gene Start:
633231

Gene Stop:
632188

Gene Length:
1044

Molecular Weight*:
39877

pI*:
7.20

Net Charge*:
0.52

EC:
1.8.1.2  

Functional Class:
central intermediary metabolism; sulfur metabolism  

Pathway: pathway table
Selenoamino acid metabolism
Sulfur metabolism

Comment:
In E.coli the sulfite reductase (CYSJ) catalyzes the reduction of sulfite to sulfide in an NADP-dependent reaction. The alpha subunit is a flavoprotein and the beta subunit is a hemoprotein.

See CT435.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to sulfite reductase sequences; e.g. residues 1-347 are 50% similar to CT435, a probable sulfite reductase; residues 27-347 are 31% similar to CYSJ_ECOLI; residues 44-347 are 27% similar to (Z99121) similar to sulfite reductase [Bacillus subtilis]; residues 27-347 are 28% similar to CYSJ_SALTY; and residues 32-347 are 27% similar to sulfite reductase (NADPH) (EC 1.8.1.2) chain MET10 - yeast (Saccharomyces cerevisiae) (strain carlsbergensis).
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0369
COG name: Sulfite reductase flavoprotein subunit
Functional Class: P
The phylogenetic pattern of COG0369 is ----Y--ceB--------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 46-315 span seven regions of similarity to blocks PR00371A-E,G,H (FLAVOPROTEIN PYRIDINE NUCLEOTIDE CYTOCHROME REDUCTASE SIGNATURE) with a combined E-value of 2.6e-21.

ProDom Summary:  Protein Domain Search
Residues 141-312 are 38% similar to a defined domain of CYSJ_ECOLI, defined as: REDUCTASE OXIDOREDUCTASE FAD FLAVOPROTEIN NITRATE NADP NAD HEME PROTEIN ELECTRON.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 183 (E-value = 3.2e-09) place CPn0548 in the FAD_binding_1 family which is described as FAD binding domain (PF00667)
Residues 212 to 324 (E-value = 2.5e-20) place CPn0548 in the NAD_binding_1 family which is described as Oxidoreductase NAD-binding domain (PF00175)

PDB Hit:


Gene Protein Sequence:
MYLQEKFKAQQVPLVLRELLSCSDSINDSDPIYRMVFDSNDTTISYKVGD
ALGVLPENSKEVSEHVLQLLGYSPTTLVNVKKTSEKVSAQKFIQGYVDLD
KIPAKLNSFFPDKDPKITLYDAIQEYRPQIPIELFAESVFPLLPRFYSIA
SSPDLHPKSIELLVKHVSYPGKYQKRFGVCSSFLCSELQVNDSAYIFVQP
TKHFTLSTQTEGKPLVMIGAGTGIAPYKAFLEERLFNKDPGNNLLFFGER
KEKVNFYYREFWNHAEEEGKLKLFLAFSRERDQKVYVQDLLRIQKDEVRK
AYEEGGFFFVCGRKVLGIEVKHALEEILGKDTLASLRKEHRYVVDVY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACCTACAAGAAAAGTTTAAGGCTCAGCAAGTTCCTCTAGTATTGCG
TGAGCTACTTTCTTGTTCCGATTCCATTAACGATAGCGATCCCATCTACC
GCATGGTCTTTGATAGCAATGATACGACTATATCCTATAAAGTAGGCGAT
GCTTTAGGAGTCTTACCAGAGAATTCTAAAGAGGTCTCCGAACACGTTCT
CCAGCTTCTAGGCTATTCCCCAACGACCCTTGTCAACGTAAAAAAAACTT
CTGAAAAAGTTTCTGCCCAAAAATTTATCCAAGGCTATGTTGATCTTGAT
AAAATTCCAGCAAAGCTAAATTCCTTTTTCCCAGACAAAGATCCTAAGAT
TACACTGTATGATGCCATTCAAGAGTACCGCCCTCAGATCCCAATAGAAC
TCTTCGCTGAGAGTGTGTTTCCTTTATTGCCTCGTTTCTACTCTATAGCC
TCCTCACCAGATCTACATCCCAAAAGTATAGAGCTATTGGTAAAACACGT
TTCCTATCCTGGAAAATATCAAAAACGCTTCGGAGTTTGCTCGTCCTTTC
TATGTAGCGAACTACAGGTCAACGATTCTGCCTACATATTCGTACAACCT
ACAAAACACTTCACTCTATCTACACAGACTGAAGGGAAACCCTTAGTTAT
GATCGGAGCTGGAACAGGAATCGCTCCTTATAAAGCCTTCCTAGAGGAAC
GCCTTTTCAATAAAGACCCAGGAAATAATTTACTATTTTTTGGTGAGCGC
AAAGAAAAAGTGAACTTCTATTATCGAGAATTCTGGAACCATGCAGAAGA
GGAAGGAAAACTAAAACTCTTTTTAGCCTTCTCAAGAGAGAGAGACCAAA
AAGTCTATGTTCAAGATCTTCTTAGGATTCAAAAAGATGAGGTAAGAAAG
GCCTATGAAGAGGGAGGGTTTTTCTTTGTCTGTGGACGTAAAGTCTTAGG
CATAGAAGTAAAACACGCTTTAGAAGAAATCTTAGGAAAAGATACTCTAG
CCTCCCTCAGAAAGGAACATCGTTACGTTGTTGACGTCTATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy