Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR436 IGR435 IGR433 IGR437 IGR438 IGR432 IGR439 IGR431 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs12, - CPn0552 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 CPn0553 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 rs12, - CPn0552 CPn0547 yebL, - CPn0541 CPn0543 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0547

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (YgbB family)

Gene Start:
631661

Gene Stop:
632191

Gene Length:
531

Molecular Weight*:
19115

pI*:
5.70

Net Charge*:
-3.43

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Predicted YgbB family member (ygbB).

Blast Summary:  PSI-Blast Search
CPn0547 is orthologously related to CT434: residues 9-175 of CPn0547 are 68% similar to residues 10-176 of CT434, a predicted conserved hypothetical protein (YgbB family) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0245
COG name: Putative enzyme of deoxyxylulose pathway (terpenoid biosynthesis), YgbB family
Functional Class:  R
The phylogenetic pattern of COG0245 is -----qvcebrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 16 to 174 (E-value = 5.8e-87) place CPn0547 in the YgbB family which is described as YgbB family (PF02542)

PDB Hit:


Gene Protein Sequence:
MDRDNEVPLPKPKWIYRTGIGQDSHRFLPESSTKPCILGGIIFDHCPGFQ
ANSDGDIIFHAICNAISSVTNKIILGKVADELLQTRGITDSGIYLEEALK
SLKPNQKISHVAITIEGSRPKFLCKLSALRQNIAQVMNLTPTDIGITATS
GEGLSDFGCGDGVQCFCVLTVMEYCD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAGAGACAATGAGGTTCCCCTGCCCAAGCCCAAATGGATTTACCG
TACAGGTATTGGTCAAGACAGCCACCGCTTTCTCCCAGAAAGTTCCACGA
AGCCCTGCATTTTAGGTGGTATCATTTTTGATCATTGCCCAGGATTTCAG
GCAAATTCCGATGGAGACATTATCTTTCATGCCATTTGTAATGCGATTTC
CTCAGTAACTAATAAAATTATTTTAGGAAAGGTTGCTGATGAGCTTCTCC
AAACACGGGGAATTACAGATAGTGGGATTTATCTTGAGGAGGCTTTAAAA
TCTCTGAAGCCTAATCAAAAGATTTCTCATGTCGCTATTACGATTGAAGG
AAGTCGACCTAAATTTCTCTGTAAGCTATCTGCATTACGTCAAAATATTG
CCCAGGTTATGAACTTAACACCTACGGATATTGGCATTACTGCGACTTCT
GGAGAGGGTTTGAGTGACTTTGGCTGTGGAGATGGCGTTCAGTGTTTCTG
CGTCTTAACTGTGATGGAATACTGTGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy