Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR436 IGR435 IGR433 IGR437 IGR432 IGR431 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0546

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl21  

Definition:
50S ribosomal protein L21

Gene Start:
631229

Gene Stop:
630909

Gene Length:
321

Molecular Weight*:
12134

pI*:
10.50

Net Charge*:
7.95

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0546 is similar to TP0745 in T. pallidum, UU212 in U. urealyticulm and MG232 in M. genitalium.

CPn0546 is orthologously related to CT420: residues 1-106 are 71% similar to resides 1-107
of CT546.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0261
COG name: Ribosomal protein L21
Functional Class:  J
The phylogenetic pattern of COG0261 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 99 (E-value = 2.7e-47) place CPn0546 in the Ribosomal_L21p family which is described as Ribosomal prokaryotic L21 protein (PF00829)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
58  
106

PDB Hit:


Gene Protein Sequence:
MEPYAVIQTGSKQYQVRSGDVIDVELLGEVASDKEVIFQDVLFVFDGTKA
SLGSPTIANAQVKAEYLSHVKGEKVVAYKYKKRKNYHRKHGHRQKYLRVK
IREILI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGCCCTACGCAGTAATCCAAACAGGAAGCAAGCAATATCAGGTTCG
CTCAGGCGATGTGATTGATGTCGAGTTACTAGGGGAAGTTGCTTCGGATA
AAGAAGTCATTTTTCAAGATGTCCTCTTTGTATTCGATGGAACTAAAGCC
TCTCTAGGAAGCCCTACGATTGCGAACGCACAAGTAAAAGCCGAATATCT
TTCTCATGTTAAAGGAGAAAAAGTAGTCGCCTATAAGTATAAAAAACGCA
AAAATTATCATCGTAAACACGGACATCGTCAGAAGTACCTTCGTGTGAAA
ATCCGTGAGATATTGATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy