Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR436 IGR435 IGR433 IGR437 IGR432 IGR431 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rs10, - CPn0549 rl21, - CPn0546 rs7, - CPn0551 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0545

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl27  

Definition:
50S ribosomal protein L27

Gene Start:
630884

Gene Stop:
630630

Gene Length:
255

Molecular Weight*:
9117

pI*:
12.10

Net Charge*:
12.22

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 50S ribosomal
protein L27 sequences, e.g., residues 1-74 is
64% similar to RK27_PORPU and residues 1-81 is
61% similar to RL27_SYNY3. CPn0545 is similar to TP0743 in T. pallidum, MG234 in M. genitalium and UU210 in U. urealyticum.

CPn0545 is orthologously related to CT419:
residues 1-82 is 86% similar to that of CT419.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0211
COG name: Ribosomal protein L27
Functional Class:  J
The phylogenetic pattern of COG0211 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 80 (E-value = 4.4e-38) place CPn0545 in the Ribosomal_L27 family which is described as Ribosomal L27 protein (PF01016)

PDB Hit:


Gene Protein Sequence:
MAHKKGQGASRNGRDSKSKRLGVKVGAGQKVSTGSILVRQRGTRWNPAQN
VGRGRDDTLFALVDGIVVMKKTNRTYISVVPEQL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACATAAGAAAGGACAAGGGGCAAGCCGAAACGGTAGAGATTCAAA
ATCGAAGCGCCTTGGGGTTAAAGTGGGCGCTGGGCAAAAAGTTTCTACAG
GAAGTATTCTCGTTCGTCAGAGAGGGACCCGATGGAATCCTGCACAAAAT
GTAGGTCGTGGTCGTGATGATACCCTATTCGCTTTAGTCGATGGTATTGT
AGTAATGAAAAAGACGAATCGTACTTATATCTCTGTTGTTCCTGAGCAAC
TTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy