Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR436 IGR435 IGR433 IGR432 IGR431 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0544

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yhbZ  

Definition:
GTP-binding protein (OBG related)

Gene Start:
630529

Gene Stop:
629522

Gene Length:
1008

Molecular Weight*:
36713

pI*:
7.20

Net Charge*:
0.61

EC:
 

Functional Class:
cellular processes; signal transduction  
uncategorized  

Pathway: pathway table

Comment:
See CT418.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to GTP binding protein sequences; e.g. residues 2-325 are 40% similar to (AE000771) GTP-binding protein [Aquifex aeolicus]; residues 2-333 are 39% similar to (D90901) GTP-binding protein [Synechocystis sp.]; residues 2-325 are 39% similar to YHBZ_ECOLI; residues 1-334 are 76% similar to CT418; residues 2-325 are 41% similar to UU461; residues 4-329 are 41% similar to MG384; and residues 2-331 are 41% similar to TP0742.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0536
COG name: Predicted GTPase
Functional Class:  R
The phylogenetic pattern of COG0536 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 36-84, 159-202, 217-238, and 277-291 represent blocks BL00905A-D (GTP1/OBG family proteins) with a combined E-value of 3.3e-39.

ProDom Summary:  Protein Domain Search
Residues 2-160 are 51% similar to a defined domain of P72931_XXXXX, defined as: PROTEIN GTP-BINDING INTERGENIC REGION PROBABLE OBG DNA FOR COMPLETE CDS.
Residues 161-288 are 48% similar to a defined domain of O51722_BORBU, defined as: PROTEIN GTP-BINDING LIPOPROTEIN PRENYLATION TRANSPORT FACTOR RAS-RELATED ELONGATION ADP-RIBOSYLATION BIOSYNTHESIS.

Paralogs:  Local Blast Search
CPn0321 is a possible paralog: residues 160-268 are 33% similar to CPn0321.

Pfam Summary:  Pfam Search
Residues 15 to 290 (E-value = 2.8e-78) place CPn0544 in the GTP1_OBG family which is described as GTP1/OBG family (PF01018)

PDB Hit:


Gene Protein Sequence:
MFVDQITLELRAGKGGNGVVAWRKEKYLPKGGPYGGNGGNGGSVIIEATT
SVYSFEAYRNIRFLKAPDGQSGATNNRTGRSGKDLIVSVPTGTLLRDAET
GEILHDFTVDGERLLVSQGGKGGKGNTFFKTSVNRAPTKATPGKPGEIRQ
VELELKLIADIGLVGFPNAGKSTLFNTLAHTEVKVGAYPFTTLAPSLGLV
LCKDRLYQKPWIIADIPGIIEGAHQNKGLGLDFLRHIERTLLLLFVIDVS
KRERNSPEEDLETLIHELHSHQPDFEKKDMLVALNKIDDLLPDEQEECLQ
SFQKRFPSYTFVLISGLTGEGVDGLYRFFTQRLAV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGTAGATCAAATTACCTTAGAATTGCGTGCTGGAAAGGGCGGAAA
CGGCGTTGTTGCTTGGAGAAAGGAAAAATACCTTCCTAAAGGAGGGCCTT
ACGGAGGCAATGGTGGCAATGGCGGCTCCGTAATCATAGAAGCCACCACA
AGTGTATATTCTTTCGAAGCTTATAGAAATATCCGCTTTCTCAAGGCTCC
CGACGGTCAGTCAGGAGCTACAAATAACCGCACAGGACGCAGTGGTAAAG
ATCTAATAGTTTCTGTCCCTACAGGCACCCTGCTTCGTGATGCTGAGACT
GGTGAAATCCTTCATGACTTTACCGTAGATGGAGAGCGTCTCCTAGTAAG
CCAAGGAGGAAAGGGAGGAAAAGGAAATACCTTCTTTAAGACCTCAGTAA
ACCGAGCCCCTACAAAAGCCACCCCAGGAAAACCCGGAGAAATCCGTCAG
GTAGAGTTAGAACTTAAGCTCATTGCTGATATCGGTTTGGTAGGGTTCCC
AAATGCAGGAAAGTCCACACTATTTAATACACTCGCACATACCGAAGTGA
AAGTCGGAGCCTATCCCTTCACAACTCTGGCCCCCTCTTTGGGCCTAGTC
CTTTGTAAAGATCGTTTGTATCAAAAACCCTGGATTATCGCTGACATTCC
AGGAATCATTGAAGGAGCTCATCAAAACAAAGGCCTAGGACTCGATTTTC
TTCGCCATATTGAGCGCACTCTTTTACTGCTATTTGTTATCGATGTCTCC
AAAAGAGAGAGAAACTCTCCCGAAGAAGACTTAGAAACGCTCATCCACGA
GCTCCACTCTCATCAGCCAGATTTTGAAAAGAAAGATATGCTGGTAGCTT
TAAATAAAATTGATGATCTTCTTCCTGACGAACAGGAAGAATGCCTCCAA
AGCTTCCAAAAGCGCTTCCCTAGCTATACATTTGTATTGATTTCAGGACT
TACAGGAGAAGGCGTCGACGGATTGTACCGCTTCTTCACACAAAGACTCG
CTGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy