Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR436 IGR435 IGR433 IGR432 IGR431 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 fusA, - CPn0550 rl27, - CPn0545 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0543

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
chelated metal transport system membrane protein

Gene Start:
628725

Gene Stop:
629606

Gene Length:
882

Molecular Weight*:
32230

pI*:
8.30

Net Charge*:
5.76

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter, permease proteins; e.g. residues 34-277 are 37% similar to (AE000842) manganese transport system membrane protein [Methanobacterium thermoautotrophicum]; residues 34-275 are 26% similar to (AF104349) hydrophobic membrane protein ZurM [Listeria monocytogenes]; residues 35-288 are 27% similar to YFED_YERPE, a chelated iron transport system membrane protein; residues 4-292 are 66% similar to CT417, a chelated metal transport system membrane protein; residues 20-265 are 23% similar to TP0166, an ABC transporter, permease protein; and residues 19-262 are 19% similar to TP0036, an ABC transporter, permease protein.
No significant similarity to M.genitalium, U.urealyticum, or M.pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1108
COG name: ABC-type Mn/Zn transport systems, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1108 is a-tk-QvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 25-71, 80-118, and 229-271 represent blocks PF00950A-C (ABC 3 transport family) with a combined E-value of 8.5e-19.

ProDom Summary:  Protein Domain Search
Residues 42-245 are 38% similar to a defined domain of O26706_METTH; defined as: PROTEIN MEMBRANE TRANSPORT TRANSMEMBRANE SYSTEM INNER ZINC MANGANESE 5'REGION ORF1.

Paralogs:  Local Blast Search
Two possible paralogs found in C.pneumoniae; CPn0347 and CPn0346, both of which are predicted integral membrane proteins. Residues 1-273 are 22% similar to CPn0347.

Pfam Summary:  Pfam Search
Residues 11 to 274 (E-value = 8.5e-48) place CPn0543 in the ABC-3 family which is described as ABC 3 transport family (PF00950)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
30
transmembrane  
44  
61
transmembrane  
69  
87
transmembrane  
105  
123
transmembrane  
143  
162
transmembrane  
183  
207
transmembrane  
224  
248
transmembrane  
253  
270

PDB Hit:


Gene Protein Sequence:
MLSSLIRDSFPLLILLPTFLAALGASVAGGVMGTYIVVKRIVSISGSISH
AILGGIGLTLWIQYKLHLSFFPMYGAIVGAIFLALCIGKIHLKYQEREDS
LIAMIWSVGMAIGIIFISRLPTFNGELINFLFGNILWVTPSDLYSLGIFD
LLVLGIVVLCHTRFLALCFDERYTALNHCSVQLWYFLLLVLTAITIVMLI
YVMGTILMLSMLVLPVAIACRFSYKMTRIMFISVLLNILCSFSGICIAYC
LDFPVGPTISLLMGLGYTASLCVKKRYNPSTPSPVSPEINTNV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTCCTCACTAATCCGTGATTCATTTCCCCTTCTTATTTTACTTCC
CACATTCCTAGCGGCATTAGGAGCCTCCGTAGCTGGCGGCGTTATGGGAA
CCTATATCGTTGTAAAACGTATTGTTTCAATTAGTGGAAGTATATCTCAT
GCAATTCTAGGAGGAATTGGCCTCACCCTATGGATACAATATAAGCTTCA
TCTCTCTTTTTTCCCTATGTATGGAGCTATTGTAGGAGCTATTTTTCTAG
CTCTTTGCATCGGCAAGATCCACCTGAAATACCAAGAAAGGGAAGACTCT
TTGATTGCGATGATTTGGTCTGTGGGCATGGCAATTGGAATTATATTCAT
TTCCAGGCTTCCCACCTTTAATGGAGAGCTCATCAATTTTCTATTTGGGA
ACATTCTCTGGGTCACCCCTTCAGACCTCTATAGCTTAGGAATCTTTGAT
CTTCTTGTTTTAGGAATTGTGGTCCTTTGCCACACCCGGTTCCTTGCTCT
TTGCTTTGATGAGAGGTACACGGCTTTAAACCATTGTTCTGTACAGCTGT
GGTATTTCCTACTTCTTGTTCTGACAGCAATCACGATTGTGATGTTGATT
TATGTGATGGGAACGATTCTGATGCTTAGCATGCTCGTCTTACCTGTTGC
TATAGCGTGTAGATTTTCGTACAAGATGACACGAATTATGTTCATCTCGG
TCCTCTTGAATATCTTATGTTCTTTTTCTGGAATTTGCATCGCCTACTGT
TTAGATTTCCCAGTAGGTCCTACGATATCATTGCTGATGGGGTTAGGTTA
TACAGCGAGTCTTTGTGTGAAGAAGCGGTACAATCCGTCGACGCCTTCTC
CTGTAAGTCCTGAAATCAATACAAATGTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy