Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR435 IGR433 IGR432 IGR431 IGR434 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl27, - CPn0545 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rs10, - CPn0549 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 rl27, - CPn0545 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0542

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
ABC transporter protein

Gene Start:
628003

Gene Stop:
628740

Gene Length:
738

Molecular Weight*:
27339

pI*:
7.80

Net Charge*:
4.55

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ABC transporter sequences; e.g. residues 1-235 are 62% similar to CT416, a predicted ABC transporter protein; residues 21-235 are 34% similar to TP0164, a predicted ABC transporter, ATP-binding protein; residues 5-213 are 33% similar to UU069, a fecE; iron(III) dicitrate transport ATP-binding protein; residues 5-215 are 40% similar to (D90903) ABC transporter [Synechocystis sp.]; and residues 22-215 are 43% similar to (AF104349) ABC transporter ZurA [Listeria monocytogenes].

COGS Summary:  COGS Search
BeTs to 10 clades of COG1121
COG name: ABC-type iron (III) transport system, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1121 is a-tk-qvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 37-48 and 142-173 represent blocks BL00211A,B (ABC transporters family proteins) with a combined E-value of 1.7e-24.

ProDom Summary:  Protein Domain Search
Residues 22-66 are 60% similar to a defined domain of O66871_AQUAE, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.
Residues 142-184 are 58% similar to a defined domain of O29819_ARCFU, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Possible paralogs in order of similarity are: CPn0348, CPn0202, CPn0683, CPn0248, CPn080, CPn0231, CPn0723, CPn0201, CPn0413, CPn0682, CPn0191, CPn0023, CPn0691, CPn0096. Residues 21-223 are 34% similar to CPn0348.

Pfam Summary:  Pfam Search
Residues 32 to 216 (E-value = 1.6e-44) place CPn0542 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
80

PDB Hit:


Gene Protein Sequence:
MTIRILAEGLAFRYGSKGPNIIHDVSFSVYDGDFIGIIGPNGGGKSTLTM
LILGLLTPTFGSLKTFPSHSAGKQTHSMIGWVPQHFSYDPCFPISVKDVV
LSGRLSQLSWHGKYKKKDFEAVDHALDLVGLSDHHHHCFAHLSGGQIQRV
LLARALASYPEILILDEPTTNIDPDNQQRILSILKKLNRTCTILMVTHDL
HHTTNYFNKVFYMNKTLTSLADTSTLTDQFCCHPYKNQEFSCSPH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAATACGAATTCTTGCTGAAGGCCTAGCTTTCCGTTACGGAAGCAA
GGGACCGAATATCATTCATGATGTTTCTTTCTCTGTCTATGATGGCGACT
TTATAGGAATCATAGGACCAAACGGAGGGGGGAAAAGCACCTTAACGATG
TTAATTTTGGGCTTGCTTACTCCTACATTCGGATCCTTGAAGACTTTCCC
TTCGCATTCCGCGGGGAAACAAACCCATTCCATGATCGGTTGGGTTCCCC
AACATTTCTCTTATGATCCTTGTTTTCCTATCTCAGTAAAAGATGTTGTC
CTCTCAGGAAGATTGTCTCAACTCTCCTGGCATGGAAAATATAAAAAGAA
AGATTTTGAAGCTGTAGATCACGCTTTGGATCTTGTTGGACTTTCTGACC
ACCACCACCACTGCTTCGCCCATCTCTCAGGAGGACAAATCCAGCGTGTA
CTTCTGGCAAGAGCCTTAGCCTCCTACCCTGAAATTTTAATTCTTGATGA
GCCGACGACAAACATTGATCCTGACAATCAACAAAGAATTTTAAGTATCC
TAAAAAAGCTCAACCGTACGTGCACCATTCTTATGGTAACTCACGATCTT
CACCATACGACGAATTACTTTAATAAAGTTTTTTATATGAACAAAACTTT
GACTTCATTGGCAGACACTTCGACCTTAACAGACCAATTTTGTTGTCATC
CCTATAAAAATCAGGAATTTTCATGCTCTCCTCACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy