Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Phe_1 tRNA_Ser_1 IGR433 IGR432 IGR431 IGR434 rl27, - CPn0545 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl27, - CPn0545 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 rl21, - CPn0546 yhbZ, - CPn0544 cysJ, - CPn0548 rl27, - CPn0545 CPn0547 yebL, - CPn0541 CPn0543 CPn0540 CPn0542 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0541

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yebL  

Definition:
probable adhesin B precursor protein

Gene Start:
627170

Gene Stop:
628006

Gene Length:
837

Molecular Weight*:
32001

pI*:
7.30

Net Charge*:
1.85

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Few significant hits in gapped BLAST; e.g. residues 8-278 are 53% similar to CT415, a probable adhesin B precursor protein; residues 24-232 are 24% similar to TP0034, a predicted ABC transporter and/or adhesion protein; resdiues 24-272 are 28% similar to (AE000842) adhesion protein [Methanobacterium thermoautotrophicum]; residues 22-272 are 27% similar to (D90903) adhesion protein [Synechocystis sp.]; and residues 12-266 are 25% similar to (AE000698) adhesion B precursor [Aquifex aeolicus].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0803
COG name: Zn-binding (lipo)protein of the ABC-type Zn transport system (surface adhesin A)
Functional Class: P
The phylogenetic pattern of COG0803 is a-tK-QvCeBrH-----LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 25-197 span four regions of similarity to blocks PR00690A-D (ADHESIN FAMILY SIGNATURE) with a combined E-value of 5.9e-09.
Residues 50-193 span four regions of similarity to blocks PR00691B-E (ADHESIN B SIGNATURE) with a combined E-value of 5.2e-08.

ProDom Summary:  Protein Domain Search
Residues 131-248 are 29% similar to a defined domain of P73085_XXXXX, defined as: PROTEIN PRECURSOR LIPOPROTEIN SIGNAL ADHESION ADHESIN MEMBRANE ZINC B TRANSPORT.

Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 3 to 276 (E-value = 1.5e-113) place CPn0541 in the SBP_bac_9 family which is described as Periplasmic solute binding protein family (PF01297)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19
coil-coil  
150  
177

PDB Hit:


Gene Protein Sequence:
MHKVIVFIFLTLYSLKSYGNDVIDKPHVLVSIAPYKFLVEQIAEETCFVY
AIVTNHYDPHTYELPPQQIKELRQGDLWFRIGEAFEKTCERNLTCQQVDL
SQNVSLIQGKPCCNQHTTNYDTHTWLSPKNLKVQVETIVTTLSKKYPQHA
TLYQSNGEKLLLALDQLNEEILTITSKAKQRHILVSHGAFGYFCRDYNFS
QHTIEKSSHVEPSPKDVARVFRDIEQYKISSVILLEYSGRRSSAMLADRF
HMHTVNLDPYAENVLVNLKTIATTFSSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATAAAGTAATAGTTTTCATTTTCCTTACCCTATATTCGTTAAAAAG
TTATGGGAATGATGTAATAGATAAGCCCCATGTTCTTGTCAGTATCGCCC
CCTATAAATTCCTAGTTGAACAAATTGCTGAAGAGACCTGTTTTGTCTAT
GCGATAGTTACGAATCACTATGATCCCCATACCTATGAACTTCCTCCTCA
GCAAATCAAGGAGTTACGACAAGGAGACCTTTGGTTCCGTATAGGAGAGG
CATTTGAAAAAACTTGTGAGAGAAACCTTACATGCCAACAAGTCGATCTT
TCCCAAAATGTCTCGCTGATTCAAGGAAAGCCTTGCTGTAATCAACATAC
CACGAACTACGACACCCACACTTGGTTAAGCCCTAAAAACCTTAAAGTCC
AAGTGGAGACTATCGTTACCACTTTAAGTAAAAAATATCCTCAACACGCG
ACTCTATATCAAAGCAATGGAGAGAAACTTCTGTTAGCTTTGGACCAACT
CAATGAGGAAATTCTTACGATTACCTCCAAAGCGAAACAACGCCATATTT
TAGTTTCCCATGGAGCCTTTGGGTATTTTTGCCGTGATTACAATTTCTCT
CAGCACACTATAGAGAAAAGCAGTCATGTTGAGCCTTCTCCTAAAGATGT
GGCTCGCGTATTTCGTGACATTGAACAGTACAAAATTTCTTCTGTGATTC
TTCTCGAATACTCTGGAAGACGAAGTAGTGCTATGCTGGCAGATCGTTTC
CACATGCATACTGTGAATCTCGATCCCTATGCGGAAAATGTACTTGTAAA
CTTAAAAACCATAGCGACGACTTTTTCTAGTTTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy