Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_1 IGR430 IGR431 yebL, - CPn0541 CPn0543 CPn0539 CPn0540 yebL, - CPn0541 CPn0543 CPn0539 CPn0540 yebL, - CPn0541 CPn0539 CPn0540 CPn0542 CPn0543 CPn0542
* Calculated from Protein Sequence

Gene ID: CPn0540

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
predicted outer membrane protein (Chlamydia-specific)

Gene Start:
621694

Gene Stop:
626865

Gene Length:
5172

Molecular Weight*:
179587

pI*:
5.40

Net Charge*:
-20.26

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0540 is similar to CT413: residues 1-1723 of CPn0540 are 36% similar to residues 1-1751 of CT413, a predicted outer membrane protein B from C. trachomatis.
CPn0540 is also similar to CT414, CT812, CT871, CT874, CT869, CT872, CT412, CT870, all predicted outer membrane proteins.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0540 is paralogous to multiple, predicted polymorphic outer membrane protein G family proteins in C. pneumoniae, i.e., CPn0444, CPn0446, CPn0005, CPn0447, CPn0445, CPn0451, CPn0013, CPn0453. As well as D family member CPn0963; E family members CPn0467, CPn0471, CPn0466; A family member CPn0539; and H family member CPn0454.

Pfam Summary:  Pfam Search
Residues 116 to 1221 (E-value = 4.2e-05) place CPn0540 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
non-globular  
22  
745
non-globular  
802  
1033

PDB Hit:


Gene Protein Sequence:
MKWLPATAVFAAVLPALTAFGDPASVEISTSHTGSGDPTSDAALTGFTQS
STETDGTTYTIVGDITFSTFTNIPVPVVTPDANDSSSNSSKGGSSSSGAT
SLIRSSNLHSDFDFTKDSVLDLYHLFFPSASNTLNPALLSSSSSGGSSSS
SSSSSSGSASAVVAADPKGGAAFYSNEANGTLTFTTDSGNPGSLTLQNLK
MTGDGAAIYSKGPLVFTGLKNLTFTGNESQKSGGAAYTEGALTTQAIVEA
VTFTGNTSAGQGGAIYVKEATLFNALDSLKFEKNTSGQAGGGIYTESTLT
ISNITKSIEFISNKASVPAPAPEPTSPAPSSLINSTTIDTSTLQTRAASA
TPAVAPVAAVTPTPISTQETAGNGGAIYAKQGISISTFKDLTFKSNSASV
DATLTVDSSTIGESGGAIFAADSIQIQQCTGTTLFSGNTANKSGGGIYAV
GQVTLEDIANLKMTNNTCKGEGGAIYTKKALTINNGAILTTFSGNTSTDN
GGAIFAVGGITLSDLVEVRFSKNKTGNYSAPITKAASNTAPVVSSSTTAA
SPAVPAAAAAPVTNAAKGGALYSTEGLTVSGITSILSFENNECQNQGGGA
YVTKTFQCSDSHRLQFTSNKAADEGGGLYCGDDVTLTNLTGKTLFQENSS
EKHGGGLSLASGKSLTMTSLESFCLNANTAKENGGGANVPENIVLTFTYT
PTPNEPAPVQQPVYGEALVTGNTATKSGGGIYTKNAAFSNLSSVTFDQNT
SSENGGALLTQKAADKTDCSFTYITNVNITNNTATGNGGGIAGGKAHFDR
IDNLTVQSNQAKKGGGVYLEDALILEKVITGSVSQNTATESGGGIYAKDI
QLQALPGSFTITDNKVETSLTTSTNLYGGGIYSSGAVTLTNISGTFGITG
NSVINTATSQDADIQGGGIYATTSLSINQCNTPILFSNNSAATKKTSTTK
QIAGGAIFSAAVTIENNSQPIIFLNNSAKSEATTAATAGNKDSCGGAIAA
NSVTLTNNPEITFKGNYAETGGAIGCIDLTNGSPPRKVSIADNGSVLFQD
NSALNRGGAIYGETIDISRTGATFIGNSSKHDGSAICCSTALTLAPNSQL
IFENNKVTETTATTKASINNLGAAIYGNNETSDVTISLSAENGSIFFKNN
LCTATNKYCSIAGNVKFTAIEASAGKAISFYDAVNVSTKETNAQELKLNE
KATSTGTILFSGELHENKSYIPQKVTFAHGNLILGKNAELSVVSFTQSPG
TTITMGPGSVLSNHSKEAGGIAINNVIIDFSEIVPTKDNATVAPPTLKLV
SRTNADSKDKIDITGTVTLLDPNGNLYQNSYLGEDRDITLFNIDNSASGA
VTATNVTLQGNLGAKKGYLGTWNLDPNSSGSKIILKWTFDKYLRWPYIPR
DNHFYINSIWGAQNSLVTVKQGILGNMLNNARFEDPAFNNFWASAIGSFL
RKEVSRNSDSFTYHGRGYTAAVDAKPRQEFILGAAFSQVFGHAESEYHLD
NYKHKGSGHSTQASLYAGNIFYFPAIRSRPILFQGVATYGYMQHDTTTYY
PSIEEKNMANWDSIAWLFDLRFSVDLKEPQPHSTARLTFYTEAEYTRIRQ
EKFTELDYDPRSFSACSYGNLAIPTGFSVDGALAWREIILYNKVSAAYLP
VILRNNPKATYEVLSTKEKGNVVNVLPTRNAARAEVSSQIYLGSYWTLYG
TYTIDASMNTLVQMANGGIRFVF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTGGCTACCAGCTACAGCTGTTTTTGCTGCCGTACTCCCCGCACT
AACAGCCTTCGGAGATCCCGCGTCTGTTGAAATAAGTACCAGCCATACAG
GATCCGGGGATCCTACAAGCGACGCTGCCTTAACAGGATTTACACAAAGT
TCCACAGAAACTGACGGTACTACCTATACCATTGTCGGTGATATCACCTT
CTCTACTTTTACGAATATTCCTGTTCCCGTAGTAACTCCAGACGCCAACG
ATAGTTCCAGCAATAGCTCTAAAGGAGGAAGTAGCAGTAGTGGAGCTACA
TCTCTAATCCGATCCTCAAACCTACACTCCGATTTTGATTTTACAAAAGA
TAGCGTGTTAGACCTCTATCACCTTTTCTTTCCTTCAGCTTCAAATACTC
TCAATCCTGCACTCCTTTCTTCCAGTAGCAGCGGTGGATCCTCGAGCAGC
AGTAGCTCCTCATCATCTGGAAGTGCATCTGCTGTTGTTGCTGCGGACCC
AAAAGGAGGCGCTGCCTTTTATAGTAACGAGGCTAACGGAACTTTAACCT
TCACTACAGACTCTGGAAATCCCGGCTCCCTGACTCTTCAGAATCTTAAA
ATGACCGGAGATGGAGCCGCCATCTACTCGAAGGGTCCTCTAGTATTTAC
TGGTTTAAAAAATCTAACCTTTACAGGAAATGAATCTCAGAAATCTGGAG
GTGCTGCCTATACTGAAGGCGCACTCACAACACAAGCAATCGTTGAAGCC
GTAACTTTTACTGGCAACACCTCGGCAGGGCAAGGAGGCGCTATCTATGT
TAAAGAAGCTACCCTATTCAATGCTCTAGACAGCCTCAAATTTGAAAAAA
ACACTTCTGGGCAAGCTGGTGGTGGAATCTATACAGAGTCTACGCTCACA
ATCTCGAACATCACAAAATCTATTGAATTTATCTCTAATAAAGCTTCTGT
CCCTGCCCCCGCTCCTGAGCCCACCTCTCCGGCTCCAAGTAGCTTAATAA
ATTCTACAACGATCGATACCTCGACTCTCCAAACCCGAGCAGCATCCGCA
ACTCCAGCAGTGGCTCCTGTTGCTGCCGTAACTCCAACACCAATCTCTAC
TCAAGAGACCGCAGGAAATGGAGGCGCTATCTATGCTAAACAAGGTATTT
CGATATCCACGTTTAAAGATCTGACCTTCAAGTCTAACTCTGCATCGGTA
GATGCCACCCTTACTGTCGATTCTAGCACTATTGGAGAATCTGGAGGTGC
TATCTTTGCAGCAGACTCTATACAAATCCAACAGTGCACGGGAACCACCT
TATTCAGTGGCAATACTGCCAATAAGTCTGGTGGGGGTATTTACGCTGTA
GGACAAGTCACCCTAGAAGATATAGCGAATCTGAAGATGACCAACAACAC
CTGTAAAGGTGAAGGTGGAGCCATCTACACTAAAAAGGCTTTAACTATCA
ACAACGGTGCCATTCTCACTACATTTTCTGGAAATACATCGACAGATAAT
GGTGGGGCTATTTTTGCTGTAGGTGGCATCACTCTCTCTGATCTTGTAGA
AGTCCGCTTTAGTAAAAATAAGACCGGAAATTATTCCGCTCCTATTACCA
AAGCGGCTAGCAACACAGCTCCTGTAGTTTCTAGCTCTACAACTGCTGCA
TCTCCTGCGGTCCCTGCTGCCGCTGCAGCACCTGTTACAAACGCAGCAAA
AGGAGGGGCTTTATATAGTACAGAAGGACTGACTGTATCTGGAATCACAT
CGATATTGTCGTTTGAAAACAACGAATGCCAGAATCAAGGAGGTGGGGCT
TACGTTACTAAAACCTTCCAGTGTTCCGATTCTCATCGCCTCCAGTTTAC
TAGTAATAAAGCAGCAGATGAAGGCGGGGGCCTGTATTGTGGTGACGATG
TCACGCTAACGAACCTGACAGGGAAAACACTATTTCAAGAGAATAGCAGT
GAGAAACATGGAGGTGGGCTCTCTCTCGCCTCAGGAAAATCTCTGACTAT
GACATCGTTAGAGAGCTTCTGCTTAAATGCAAATACAGCAAAGGAAAACG
GAGGCGGTGCGAATGTCCCTGAAAATATTGTACTCACCTTCACCTATACT
CCCACTCCAAATGAACCTGCGCCTGTGCAGCAGCCCGTGTATGGAGAAGC
TCTTGTTACTGGAAATACAGCCACAAAAAGTGGTGGGGGCATTTACACGA
AAAATGCGGCCTTCTCAAATTTATCTTCTGTAACTTTTGATCAAAATACC
TCTTCAGAAAATGGTGGTGCCTTACTTACCCAAAAAGCTGCAGATAAAAC
GGACTGTTCTTTCACCTATATTACAAATGTCAATATCACCAACAATACAG
CTACAGGAAATGGTGGGGGCATTGCTGGGGGAAAAGCACATTTCGATCGC
ATTGATAATCTTACAGTCCAAAGCAACCAAGCAAAGAAAGGTGGTGGGGT
TTATCTTGAAGATGCCCTCATCCTGGAAAAGGTTATTACAGGTTCTGTCT
CACAAAATACAGCTACAGAAAGTGGTGGGGGTATCTACGCTAAGGATATT
CAACTACAAGCTCTACCTGGAAGCTTCACAATTACCGATAATAAAGTCGA
AACTAGTCTTACTACTAGCACTAATTTATATGGTGGGGGCATCTATTCCA
GTGGAGCTGTCACGCTAACCAATATATCTGGAACCTTTGGCATTACAGGA
AACTCTGTTATCAATACAGCGACATCCCAGGATGCAGATATACAAGGTGG
GGGCATTTATGCAACCACGTCTCTCTCAATAAATCAATGTAATACACCCA
TTCTATTTAGCAACAACTCTGCTGCCACTAAAAAAACATCAACAACAAAG
CAAATTGCTGGTGGGGCTATCTTCTCCGCTGCAGTAACTATCGAGAATAA
CTCTCAGCCCATTATTTTCTTAAATAATTCCGCAAAGTCGGAAGCAACTA
CAGCAGCAACTGCAGGAAATAAAGATAGCTGTGGAGGAGCCATTGCAGCT
AACTCTGTTACTTTAACAAATAACCCTGAAATAACCTTTAAAGGAAATTA
TGCAGAAACTGGAGGAGCGATTGGCTGTATTGATCTTACTAATGGCTCAC
CTCCCCGTAAAGTCTCTATTGCAGACAACGGTTCTGTCCTTTTTCAAGAC
AACTCTGCGTTAAATCGCGGAGGCGCTATCTATGGAGAGACTATCGATAT
CTCCAGGACAGGTGCGACTTTCATCGGTAACTCTTCAAAACATGATGGAA
GTGCAATTTGCTGTTCAACAGCCCTAACTCTTGCGCCAAACTCCCAACTT
ATCTTTGAAAACAATAAGGTTACGGAAACCACAGCCACTACAAAAGCTTC
CATAAATAATTTAGGAGCTGCAATTTATGGAAATAATGAGACTAGTGACG
TCACTATCTCTTTATCAGCTGAGAATGGAAGTATTTTCTTTAAAAACAAT
CTATGCACAGCAACAAACAAATACTGCAGTATTGCTGGAAACGTAAAATT
TACAGCAATAGAAGCTTCAGCAGGGAAAGCTATATCTTTCTATGATGCAG
TTAACGTTTCCACCAAAGAAACAAATGCTCAAGAGCTAAAATTAAATGAA
AAAGCGACAAGTACAGGAACGATTCTATTTTCTGGGGAACTTCACGAAAA
TAAATCCTATATTCCACAGAAAGTCACTTTCGCACATGGGAATCTCATTC
TAGGTAAAAATGCAGAACTTAGCGTAGTTTCCTTTACCCAATCTCCAGGC
ACCACAATCACTATGGGCCCAGGATCGGTTCTTTCCAACCATAGCAAAGA
AGCAGGAGGAATCGCTATAAACAATGTCATCATTGATTTTAGTGAAATCG
TTCCTACTAAAGATAATGCAACAGTAGCTCCACCCACTCTTAAATTAGTA
TCGAGAACTAATGCAGATAGTAAAGATAAGATTGATATTACAGGAACTGT
GACTCTTCTAGATCCTAATGGCAACTTATATCAAAATTCTTATCTTGGTG
AAGACCGCGATATCACTCTTTTCAATATAGACAATTCTGCAAGTGGGGCA
GTTACAGCCACGAATGTCACCCTTCAAGGGAATTTAGGAGCTAAAAAAGG
ATATTTAGGAACCTGGAATTTGGATCCAAATTCCTCGGGTTCAAAAATTA
TTCTAAAATGGACCTTTGACAAATACCTGCGCTGGCCCTACATCCCTAGA
GACAACCACTTCTACATCAACTCTATTTGGGGAGCACAAAACTCTTTAGT
GACTGTGAAACAAGGGATCTTAGGGAACATGTTGAACAATGCAAGGTTTG
AAGATCCTGCTTTCAACAACTTCTGGGCTTCGGCTATAGGATCTTTCCTT
AGGAAAGAAGTATCTCGAAATTCTGACTCATTCACCTATCATGGCAGAGG
CTATACCGCTGCTGTGGATGCCAAACCTCGCCAAGAATTTATTTTAGGAG
CTGCCTTCAGTCAGGTTTTTGGTCACGCCGAGTCTGAATATCACCTTGAC
AACTATAAGCATAAAGGCTCAGGTCACTCTACACAAGCATCTCTTTATGC
TGGCAATATCTTCTATTTTCCTGCGATACGGTCTCGGCCTATTCTATTCC
AAGGTGTGGCGACCTATGGTTATATGCAACATGACACCACAACCTACTAT
CCTTCTATTGAAGAAAAAAATATGGCAAACTGGGATAGCATTGCTTGGTT
ATTTGATCTGCGTTTCAGTGTGGATCTTAAAGAACCTCAACCTCACTCTA
CAGCAAGGCTTACCTTCTATACAGAAGCTGAGTATACCAGAATTCGCCAG
GAGAAATTCACAGAGCTAGACTATGATCCTAGATCTTTCTCTGCATGCTC
TTATGGAAACTTAGCAATTCCTACTGGATTCTCTGTAGACGGAGCATTAG
CTTGGCGTGAGATTATTCTATATAATAAAGTATCAGCTGCGTACCTCCCT
GTGATTCTCAGGAATAATCCAAAAGCGACCTATGAAGTTCTCTCTACAAA
AGAAAAGGGCAACGTAGTCAACGTTCTCCCTACAAGAAACGCAGCTCGTG
CAGAGGTGAGCTCTCAAATTTATCTTGGAAGTTACTGGACACTCTACGGC
ACGTATACTATTGATGCTTCAATGAATACTTTAGTGCAAATGGCCAACGG
AGGGATCCGGTTTGTATTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy