Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR425 IGR428 IGR424 IGR426 IGR427 IGR430 IGR429 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0539

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
outer membrane protein A (approx. 98 kDa)

Gene Start:
618705

Gene Stop:
621548

Gene Length:
2844

Molecular Weight*:
103639

pI*:
8.70

Net Charge*:
12.87

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
'GGA(I)' locally dispersed repeats seem to be conserved among homologous proteins.

Blast Summary:  PSI-Blast Search
CPn0539 is orthologously related to CT412, CT871, CT869, CT874 CT872, CT812, CT870, CT413, CT414. They are all predicted outer membrane proteins.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0539 is paralogously related to other seventeen outer membrane proteins, namely, CPn0449, CPn0446, CPn0451, CPn0445, CPn0447, CPn0444, CPn0453, CPn0454, CPn0471, CPn0013, CPn0466, CPn0467, CPn0005, CPn0540, CPn0963, CPn0542, CPn0470.

Pfam Summary:  Pfam Search
Residues 3 to 453 (E-value = 2.5e-08) place CPn0539 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19

PDB Hit:


Gene Protein Sequence:
MKQMRLWGFLFLSSFCQVSYLRANDVLLPLSGIHSGEDLELFTLRSSSPT
KTTYSLRKDFIVCDFAGNSIHKPGAAFLNLKGDLFFINSTPLAALTFKNI
HLGARGAGLFSESNVTFKGLHSLVLENNESWGGVLTTSGDLSFINNTSVL
CQNNISYGPGGALLLQGRKSKALFFRDNRGTILFLKNKAVNQDESHPGYG
GAVSSISPGSPITFADNQEILFQENEGELGGAIYNDQGAITFENNFQTTS
FFSNKASFGGAVYSRYCNLYSQWGDTLFTKNAAAKVGGAIHADYVHIRDC
KGSIVFEENSATAGGAIAVNAVCDINAQGPVRFINNSALGLNGGAIYMQA
TGSILRLHANQGDIEFCGNKVRSQFHSHINSTSNFTNNAITIQGAPREFS
LSANEGHRICFYDPIISATENYNSLYINHQRLLEAGGAVIFSGARLSPEH
KKENKNKTSIINQPVRLCSGVLSIEGGAILAVRSFYQEGGLLALGPGSKL
TTQGKNSEKDKIVITNLGFNLENLDSSDPAEIRATEKASIEISGVPRVYG
HTESFYENHEYASKPYTTSIILSAKKLVTAPSRPEKDIQNLIIAESEYMG
YGYQGSWEFSWSPNDTKEKKTIIASWTPTGEFSLDPKRRGSFIPTTLWST
FSGLNIASNIVNNNYLNNSEVIPLQHLCVFGGPVYQIMEQNPKQSSNNLL
VQHAGHNVGARIPFSFNTILSAALTQLFSSSSQQNVADKSHAQILIGTVS
LNKSWQALSLRSSFSYTEDSQVMKHVFPYKGTSRGSWRNYGWSGSVGMSY
AYPKGIRYLKMTPFVDLQYTKLVQNPFVETGYDPRYFSSSEMTNLSLPIG
IALEMRFIGSRSSLFLQVSTSYIKDLRRVNPQSSASLVLNHYTWDIQGVP
LGKEALNITLNSTIKYKIVTAYMGISSTQREGSNLSANAHAGLSLSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCAGATGCGTCTTTGGGGATTTTTATTTCTCTCTTCCTTCTGTCA
AGTTTCTTATCTACGAGCAAACGATGTTCTCCTCCCTCTATCAGGGATTC
ATTCTGGAGAAGACCTTGAACTCTTTACTCTACGCAGTTCCTCCCCAACA
AAAACTACGTATTCTCTACGCAAAGATTTTATTGTTTGTGATTTTGCAGG
AAATTCTATTCACAAGCCTGGAGCTGCATTCCTGAACTTAAAAGGCGATC
TATTTTTTATAAATAGCACTCCCCTAGCGGCTCTTACCTTTAAAAACATT
CACTTAGGAGCTCGCGGTGCTGGGCTCTTCTCGGAATCCAATGTGACCTT
CAAAGGCCTGCACTCTCTCGTTCTCGAAAACAACGAAAGTTGGGGAGGCG
TCCTCACCACATCTGGCGACCTTTCCTTCATAAATAATACCAGTGTGCTT
TGTCAAAACAACATTAGCTATGGACCTGGAGGAGCGCTACTCTTACAAGG
AAGAAAAAGCAAGGCTCTCTTTTTCAGAGACAATCGAGGAACAATTCTAT
TTCTGAAAAACAAAGCCGTGAATCAAGATGAATCCCATCCTGGGTACGGA
GGAGCTGTAAGTAGTATAAGTCCTGGCTCCCCGATTACCTTCGCTGACAA
CCAAGAAATCCTATTCCAAGAGAATGAGGGCGAACTTGGTGGAGCCATTT
ATAACGATCAGGGTGCCATAACTTTTGAGAATAACTTTCAAACCACAAGC
TTTTTCTCTAACAAAGCTAGTTTCGGAGGAGCTGTCTATAGCCGCTACTG
CAATCTCTATTCACAGTGGGGCGATACCCTATTCACTAAAAACGCTGCTG
CAAAAGTAGGCGGAGCCATCCATGCGGATTATGTTCATATAAGAGACTGT
AAAGGAAGCATCGTCTTTGAGGAGAACTCAGCAACAGCTGGAGGGGCAAT
CGCAGTAAATGCAGTTTGTGACATTAATGCTCAAGGTCCTGTTCGCTTTA
TAAATAACTCTGCGTTAGGACTAAATGGTGGTGCTATTTATATGCAGGCT
ACTGGATCTATATTGCGCTTACATGCAAATCAAGGAGATATTGAATTTTG
TGGAAATAAAGTACGATCGCAGTTTCATTCACATATAAATTCCACTTCAA
ACTTCACAAATAATGCCATTACTATCCAAGGAGCGCCTCGAGAATTTTCG
CTCAGCGCGAATGAAGGACATCGCATCTGTTTCTATGATCCTATAATTTC
TGCAACAGAAAACTATAACTCTCTGTACATCAACCATCAGAGACTTTTAG
AAGCCGGGGGTGCTGTGATCTTTTCAGGAGCACGCCTATCTCCAGAGCAT
AAAAAAGAAAATAAGAACAAAACTTCGATTATAAACCAGCCCGTACGTCT
CTGTTCTGGAGTCCTTTCTATAGAAGGGGGCGCGATTCTTGCTGTTCGTT
CTTTTTATCAAGAAGGAGGTCTTCTTGCTCTCGGGCCAGGTTCTAAACTG
ACCACTCAAGGGAAAAATTCTGAAAAAGATAAAATTGTCATCACAAATTT
AGGATTCAACCTAGAAAATCTAGACTCTTCGGATCCTGCAGAAATCCGAG
CTACAGAAAAAGCCTCTATTGAAATTTCTGGAGTTCCTAGAGTCTATGGT
CACACAGAATCTTTCTATGAAAATCATGAGTATGCCTCCAAACCTTATAC
AACTTCGATTATTCTATCTGCCAAAAAACTTGTTACAGCTCCCTCTAGGC
CAGAGAAAGACATCCAAAATCTCATCATCGCTGAATCTGAGTATATGGGC
TACGGCTATCAAGGCTCATGGGAATTCTCCTGGTCTCCTAACGACACTAA
AGAAAAGAAAACCATTATAGCCTCTTGGACTCCTACAGGAGAATTTTCTT
TAGATCCGAAGCGCCGTGGATCTTTCATTCCCACAACCTTATGGTCGACA
TTCTCTGGGCTGAATATAGCATCGAATATCGTGAATAACAATTACCTCAA
CAACTCCGAGGTCATCCCCCTGCAACATCTCTGTGTTTTTGGAGGCCCTG
TCTATCAGATTATGGAGCAAAATCCTAAACAGAGCTCTAACAATCTCTTA
GTTCAACATGCGGGTCATAATGTTGGAGCTAGAATTCCTTTCTCTTTCAA
TACCATATTGAGTGCTGCACTTACTCAACTCTTCTCTTCTTCATCACAAC
AAAATGTTGCTGATAAGAGCCACGCGCAAATATTGATAGGGACTGTATCT
CTTAATAAAAGTTGGCAAGCACTATCTCTTAGATCTTCATTTAGCTATAC
GGAAGACTCTCAGGTAATGAAGCACGTATTCCCCTATAAAGGGACCTCTC
GAGGATCTTGGAGAAACTACGGATGGTCCGGATCTGTCGGCATGTCTTAC
GCCTATCCTAAAGGAATCCGCTATCTAAAGATGACTCCCTTTGTTGACCT
TCAGTATACAAAGTTAGTACAAAATCCCTTTGTGGAAACGGGTTATGACC
CTAGATATTTTTCTTCCTCGGAGATGACGAACCTATCTCTACCGATAGGT
ATCGCTTTAGAAATGCGCTTTATAGGCTCGCGTTCTTCCCTATTTCTCCA
AGTCAGCACCTCGTACATTAAAGACTTACGTCGGGTCAACCCACAATCTT
CAGCTTCCTTGGTGTTAAATCACTACACGTGGGATATCCAAGGAGTCCCT
CTAGGGAAAGAAGCTCTAAACATTACCTTAAATAGCACGATTAAGTACAA
GATTGTGACTGCCTATATGGGGATTTCTAGCACCCAACGAGAAGGCAGTA
ACCTTTCGGCAAATGCTCATGCAGGCCTCTCCCTTAGTTTCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy