Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR428 IGR424 IGR426 IGR427 IGR430 IGR429 IGR423 ribC, - CPn0532 CPn0531 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 ribC, - CPn0532 CPn0531 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 ribC, - CPn0532 CPn0531 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0538

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
618212

Gene Stop:
618514

Gene Length:
303

Molecular Weight*:
11604

pI*:
11.60

Net Charge*:
22.60

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0538 is orthologously related to CT814: residues 1-98 of CPn0537 are 65% similar to residues 35-129 of CT814, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
100

PDB Hit:


Gene Protein Sequence:
MFRNNHKPKKTKCKRFRWLRGVLFGGFIATLLTCLFTPKSGVQLRKKILK
VKNSGAKKSRVFFKNSKQHTKSFVKQAKLLAKNISHELQDFKKGILDDKD
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAGGAACAACCACAAACCTAAAAAAACTAAGTGCAAACGATTTCG
CTGGCTACGGGGTGTTTTATTCGGTGGATTCATAGCTACGTTATTAACAT
GCTTGTTTACTCCCAAAAGTGGCGTCCAACTGCGGAAGAAAATCCTCAAA
GTAAAAAACTCTGGGGCAAAAAAAAGTAGAGTGTTCTTTAAAAATTCCAA
GCAACATACCAAGTCATTCGTAAAACAAGCGAAGTTGCTAGCTAAGAATA
TCTCACACGAACTTCAAGATTTTAAAAAGGGAATCCTCGACGACAAAGAT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy