Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR428 IGR424 IGR426 IGR427 IGR430 IGR429 IGR423 ribC, - CPn0532 CPn0531 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 ribC, - CPn0532 CPn0531 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 ribC, - CPn0532 CPn0531 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0537

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
617833

Gene Stop:
618192

Gene Length:
360

Molecular Weight*:
13856

pI*:
10.30

Net Charge*:
10.94

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CPn0537 is somewhat orthologously related to CT814.1: residues 1-119 of CPn0537 are 42% similar to residues 1-120 of CT814.1, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
31
non-globular  
48  
119

PDB Hit:


Gene Protein Sequence:
MDNYLLGSLIFCCVLLSIGMCTIFVMTICFLRQLNKILKNIHRVTTILNF
EAKILAPLMLGKKLLCGWLKKRKNRGSLSEDIDELLDEKKQRSWKKNLDQ
GIKWCAALVLIWKVFRNKD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAACTATCTCCTCGGAAGCTTGATTTTCTGTTGTGTACTTCTATC
AATAGGGATGTGCACGATTTTCGTGATGACGATCTGCTTTCTACGCCAAC
TCAATAAAATCCTTAAAAACATCCATCGGGTGACTACAATTTTAAATTTT
GAGGCTAAGATCCTAGCTCCTTTGATGTTAGGGAAAAAGCTTCTCTGTGG
ATGGCTAAAGAAAAGAAAAAATCGCGGCTCTCTGTCTGAAGACATTGACG
AACTCTTAGATGAGAAAAAGCAGAGAAGCTGGAAAAAAAACTTAGACCAA
GGAATTAAATGGTGCGCAGCACTGGTCCTCATTTGGAAAGTGTTTCGTAA
TAAAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy