Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR428 IGR424 IGR426 IGR427 IGR430 IGR429 IGR421 IGR423 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0540 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0536

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dagA_1  

Definition:
alanine glycine carrier permease/ sodium-dependent

Gene Start:
616345

Gene Stop:
617694

Gene Length:
1350

Molecular Weight*:
49469

pI*:
9.30

Net Charge*:
12.91

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to amino acid permease sequences; e.g. residues 1-448 are 68% similar to CT409, a predicted alanine glycine carrier permease/sodium dependant; residues 4-433 are 25% similar to CT735, a predicted D-alanine/glycine permease; residues 16-431 are 26% similar to TP0414, a predicted D-alanine glycine permease; residues 1-378 are 25% similar to TP0998 amino acid transporter/ probable sodium,proton-dependent alanine transporter; residues 12-433 are 25% similar to Y883_HAEIN; and residues 10-437 are 25% similar to (AE000603) D-alanine glycine permease (dagA) [Helicobacter pylori 26695].

COGS Summary:  COGS Search
BeTs to 6 clades of COG1115
COG name: Sodium-alanine symporters
Functional Class:  E
The phylogenetic pattern of COG1115 is ---k----eB-Huj---LIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 67-117, 185-236, and 268-299 represent blocks BL00873A-C (Sodium:alanine symporter family proteins) with a combined E-value of 5.2e-27.

ProDom Summary:  Protein Domain Search
Residues 179-433 are 28% similar to a defined domain of Y883_HAEIN, defined as: TRANSPORT PROTEIN TRANSMEMBRANE SYMPORT AMINO-ACID SODIUM INNER MEMBRANE D-ALANINE GLYCINE.
Residues 58-163 are 36% similar to a defined domain of O25596_XXXXX, defined as: TRANSPORT PROTEIN TRANSMEMBRANE AMINO-ACID PERMEASE ACID AMINO INNER MEMBRANE COTRANSPORTER.

Paralogs:  Local Blast Search
CPn0876 is a probable paralog. Residues 17-441 are 27% similar to CPn0876, a predicted D-alamine/glycine permease sequence.

Pfam Summary:  Pfam Search
Residues 46 to 438 (E-value = 6.1e-17) place CPn0536 in the Na_Ala_symp family which is described as Sodium:alanine symporter family (PF01235)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
31
transmembrane  
78  
102
transmembrane  
107  
124
transmembrane  
144  
166
transmembrane  
184  
201
transmembrane  
208  
227
transmembrane  
232  
249
transmembrane  
306  
323
transmembrane  
346  
368
transmembrane  
378  
395
transmembrane  
400  
424

PDB Hit:


Gene Protein Sequence:
MNRLLSLLSVFDDFFWSYVAFILIIVLGVSFSWKSRFFQFTKFSQFCKLF
RYYSQNPQERETKQGVHPLKVFFASAGGNIGIGNVVGIVTAACIGGPGAL
FWVWIAGIFGSIVKYSEVYLGIKFRKLDRDGVYQGGPMYFLIKAFKTPVV
SVIVAILLCIYGVEIYQFSVITDSLAHCWNLPKVYPMLGLLFLVFYAIRG
GLQRIGKICSIVLPFFMLLYCALSLYILVKEFHTLPHLLSTVFSSAFKGQ
SALGGFAGCTVATTIHQGISRAAYSGDIGIGFDSIIQSESSAKDPSTQAQ
LSIVGIAIDNLICTLSLLMVLASGSWSLGLENASQVVEHTLASYFPMVKF
FLPTFFFVTGYTTIISYFLVGKKCAKFLYGNTGAKIYTLYGLLILPLFCF
LSQNTALLIMSVSGALLLCFNLLGVFILRKEVIFPARAASLTETSLSTE$


Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCGTCTTCTATCGCTTTTATCCGTCTTTGATGATTTTTTCTGGTC
CTATGTGGCCTTTATTCTAATCATTGTTCTAGGTGTAAGTTTTTCCTGGA
AGTCGCGATTTTTTCAATTCACGAAGTTCTCTCAGTTTTGCAAGCTTTTC
CGTTATTACTCTCAGAATCCTCAAGAAAGAGAAACAAAGCAAGGTGTCCA
TCCTCTAAAAGTATTTTTTGCCTCCGCAGGCGGAAATATCGGCATAGGGA
ATGTCGTAGGAATTGTCACAGCAGCATGTATCGGTGGACCCGGGGCTCTT
TTCTGGGTGTGGATTGCTGGGATCTTTGGTTCTATTGTTAAATATTCTGA
GGTCTATCTCGGAATCAAGTTCCGTAAGTTAGATCGTGATGGCGTCTATC
AGGGCGGGCCTATGTATTTTCTTATAAAGGCGTTCAAAACCCCTGTCGTG
TCTGTTATTGTTGCGATTCTTCTCTGCATTTATGGAGTGGAAATCTATCA
ATTTTCAGTCATCACTGACAGCCTTGCCCACTGTTGGAACCTACCTAAAG
TCTATCCGATGTTAGGTCTACTCTTCCTTGTTTTCTATGCAATTCGAGGA
GGCTTGCAGCGTATAGGAAAAATTTGTTCTATAGTTCTTCCTTTCTTCAT
GCTCTTATACTGTGCCCTATCCCTCTACATCCTCGTTAAAGAGTTTCATA
CCCTTCCACACCTACTTTCCACAGTATTTTCTTCTGCATTTAAAGGTCAA
AGTGCCCTTGGAGGATTTGCAGGCTGTACTGTAGCCACTACGATTCATCA
AGGAATTTCACGAGCAGCCTATTCTGGGGATATCGGTATAGGCTTTGACT
CCATCATTCAGAGTGAAAGTTCTGCTAAAGATCCTAGCACCCAAGCGCAA
CTCAGTATTGTTGGGATTGCCATAGATAACCTGATCTGTACTCTGAGTCT
TCTCATGGTGCTTGCTTCGGGCTCCTGGTCTCTGGGATTAGAGAATGCTT
CCCAAGTAGTAGAACACACTCTAGCAAGCTACTTCCCTATGGTGAAGTTC
TTCCTCCCCACCTTCTTCTTTGTTACAGGCTATACAACCATCATCTCCTA
CTTCCTGGTTGGGAAGAAGTGTGCAAAGTTTCTTTACGGAAACACAGGGG
CAAAGATCTATACTCTCTATGGTCTTCTGATTCTTCCCTTATTTTGTTTC
CTCAGCCAAAACACAGCTTTGTTGATCATGTCTGTATCTGGAGCCCTACT
CCTTTGCTTTAACCTCTTAGGAGTCTTCATCTTAAGAAAAGAAGTTATCT
TCCCTGCAAGGGCTGCTTCTCTCACAGAAACTTCTCTTTCTACAGAATAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy