Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR428 IGR424 IGR426 IGR427 IGR429 IGR421 IGR423 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0535

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lspA  

Definition:
prolipoprotein signal peptidase (LSPA-related)

Gene Start:
615793

Gene Stop:
616299

Gene Length:
507

Molecular Weight*:
19349

pI*:
10.60

Net Charge*:
9.65

EC:
3.4.23.36  

Functional Class:
cellular processes; standard protein secretion  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to lipoprotein signal peptidase sequences; e.g. residues 5-167 are 31% similar to LSPA_STAAU; residues 7-168 are 29% similar to LSPA_HAEIN; residues 9-161 are 29% similar to LSPA_ENTAE; and residues 1-166 are 53% similar to CT408. Residues 53-163 are 27% similar to TP0978. No significant similarity to M.genitalium, U.urealyticum, or M.pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0597
COG name: Lipoprotein signal peptidase
Functional Class:  N
The phylogenetic pattern of COG0597 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 51-74, 101-126, and 136-155 represent BL00855A-C (Signal peptidases II proteins) with a combined E-value of 9.9e-20.

ProDom Summary:  Protein Domain Search
Residues 10-154 are 34% similar to a defined domain of LSPA_STAAU, defined as: SIGNAL PEPTIDASE II LIPOPROTEIN PROLIPOPROTEIN SPASE HYDROLASE ASPARTYL PROTEASE TRANSMEMBRANE.
Residues 10-154 are 37% similar to a defined domain of LSPA_STACA, defined as; SIGNAL PEPTIDASE II LIPOPROTEIN PROLIPOPROTEIN SPASE HYDROLASE ASPARTYL PROTEASE TRANSMEMBRANE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 165 (E-value = 4e-22) place CPn0535 in the Peptidase_A8 family which is described as Signal peptidase (SPase) II (PF01252)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
49  
121

PDB Hit:


Gene Protein Sequence:
MATRFRSTLLVITLFVLIDWVTKLVVLLQYKDLQILTHPTLYTHSWGRFS
FSIAPVFNEGAAFGLFSNYKYFLFLLRIFVILGLLAYLFFKKKSIQSTTQ
TALVLLCAGAIGNVGDIIFYGHIVDFISFNYKQWAFPTFNVADVLISLGT
LLLVYKFYFPTKQTEKKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACTCGTTTTCGTAGCACACTATTAGTGATTACTCTGTTTGTTTT
AATCGACTGGGTCACCAAGCTTGTTGTCTTATTACAATACAAAGATCTCC
AAATTTTAACGCACCCCACCTTATATACTCATAGTTGGGGGCGGTTTTCA
TTTTCAATTGCTCCTGTATTTAATGAAGGGGCTGCTTTCGGTCTCTTTTC
AAATTATAAATATTTCTTATTCCTTCTGCGGATATTTGTGATTCTTGGCC
TCCTGGCCTATCTTTTTTTTAAAAAAAAATCTATACAATCTACAACGCAG
ACTGCTCTAGTCCTTCTCTGTGCAGGAGCTATAGGAAACGTCGGGGATAT
TATCTTTTACGGCCACATAGTCGATTTCATTTCTTTCAATTATAAACAAT
GGGCATTCCCCACCTTTAACGTTGCCGATGTATTGATTTCTCTTGGCACT
CTGCTCCTTGTTTATAAATTTTATTTTCCTACAAAACAAACTGAAAAAAA
GAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy