Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR428 IGR424 IGR426 IGR427 IGR429 IGR421 IGR423 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0534

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dksA  

Definition:
DnaK suppressor

Gene Start:
615413

Gene Stop:
615787

Gene Length:
375

Molecular Weight*:
13927

pI*:
4.80

Net Charge*:
-5.56

EC:
 

Functional Class:
cellular processes; chaperones  
regulatory functions  

Pathway: pathway table

Comment:
DnaK supressor protein is a dosage-dependent suppressor of a DnaK
deletion mutation. It suppresses the
temperature-sensitive growth and the filamentous
phenotype of the DnaK deletion strain. DksA does not suppress the defect of
lambda growth.
DksA contains a C4, DksA/TraR-type, zinc finger.
There is similarity in the N-terminal half to the N-terminal of B.subtilis YzwB.


Blast Summary:  PSI-Blast Search
Cpn0534 is orthologously related to CT407: residues 1-124 of CPn0534 are 89% similar to residues 1-124 of CT407, a predicted DnaK suppressor protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1734
COG name: DnaK suppressor protein DskA
Functional Class:  T
The phylogenetic pattern of COG1734 is -----Q--eB-h----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 50 to 120 (E-value = 2.2e-06) place CPn0534 in the zf-dskA_traR family which is described as Prokaryotic dksA/traR C4-type zinc finger (PF01258)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
28

PDB Hit:


Gene Protein Sequence:
VPLSDDEIEQFKKRLLEMKAKLSHTLEGNAQEVKKPNEATGYSQHQADQG
TDTFDRTISLEVTTKEYELLRQINRALEKINESSYGICDVSGEEIPLARL
IAIPYATMTVKAQEQFEKGLLSGN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCGTTATCAGATGACGAAATAGAACAGTTTAAAAAAAGACTTTTGGA
GATGAAGGCAAAGTTATCGCATACTCTAGAAGGGAACGCTCAAGAGGTAA
AAAAACCTAACGAAGCTACAGGATATTCTCAGCATCAAGCAGACCAAGGT
ACCGACACCTTTGATCGGACTATTAGCCTAGAAGTCACTACAAAAGAATA
TGAGCTTCTAAGACAAATTAATAGGGCTCTAGAAAAAATTAATGAGTCTT
CTTACGGGATTTGTGATGTCAGCGGAGAAGAAATTCCTCTCGCTAGGTTG
ATAGCCATTCCCTATGCTACCATGACAGTCAAAGCTCAAGAGCAGTTTGA
AAAAGGACTCCTATCTGGAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy