Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR428 IGR424 IGR426 IGR427 IGR429 IGR421 IGR423 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0533

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
614930

Gene Stop:
615388

Gene Length:
459

Molecular Weight*:
17451

pI*:
8.90

Net Charge*:
5.72

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0533 is orthologously related to CT406: residues 1-152 of CPn0533 are 91% similar to residues 1-152 of CT406, a predicted conserved hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1327
COG name: Uncharacterized BCR
Functional Class:  S
The phylogenetic pattern of COG1327 is ------vcebrh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 48 to 138 (E-value = 4.6e-29) place CPn0533 in the ATP-cone family which is described as ATP cone domain (PF03477)

PDB Hit:


Gene Protein Sequence:
MQCPFCNHGELKVIDSRNAPEANAIKRRRECLKCSQRFTTFETVELTLQV
LKRDGRYENFQESKLIHGLNAASSHTRIGQDQVHAIASNVKSELLGKQNR
EISTKEIGELVMKYLKKADMIAYIRFACVYRRFKDVGELMEVLLSATPDM
EK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGTGTCCTTTTTGCAATCATGGGGAGTTGAAAGTTATAGATTCAAG
AAACGCTCCAGAAGCTAATGCAATAAAACGCCGTCGGGAATGCTTAAAGT
GCTCCCAACGTTTTACGACCTTTGAAACCGTTGAACTTACTTTACAAGTA
CTAAAACGTGATGGTCGCTACGAAAATTTTCAAGAATCTAAATTAATTCA
CGGTCTGAACGCAGCTTCTAGCCACACACGGATTGGTCAAGACCAAGTTC
ATGCTATAGCTTCTAATGTTAAATCTGAACTCTTAGGTAAACAAAATAGG
GAAATTTCTACCAAAGAAATTGGCGAACTAGTAATGAAATATCTTAAAAA
GGCTGATATGATTGCCTACATCCGATTTGCCTGCGTTTATCGTCGATTCA
AGGACGTTGGTGAATTAATGGAAGTTTTATTGTCAGCAACTCCAGATATG
GAAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy