Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR420 IGR428 IGR424 IGR426 IGR427 IGR429 IGR421 IGR423 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0539 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0532

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribC  

Definition:
riboflavin synthase subunit alpha

Gene Start:
614674

Gene Stop:
614072

Gene Length:
603

Molecular Weight*:
21686

pI*:
4.80

Net Charge*:
-6.75

EC:
2.5.1.9  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; riboflavin  

Pathway: pathway table
Riboflavin metabolism

Comment:
Riboflavin synthase is necessary for the synthesis of riboflavin from
5-amino-6-(1'-D)-ribityl-amino-2,4 pyrimidinedione. In B.subtilis, the
enzyme consists of 3 alpha subunits and 60 beta subunits. The alpha subunit
is reported to separately catalyze the formation of riboflavin from
6,7-dimethyl-8-lumazine. An Xray crystallographic structure is available.

Blast Summary:  PSI-Blast Search
CPn0532 is orthologous to CT405, a predicted riboflavin synthase alpha subunit:
residues 1-195 are 47% similar to CT405. No similarity to T.pallidum, M.genitalium or
U.urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0307
COG name: Riboflavin synthase alpha chain
Functional Class: H
The phylogenetic pattern of COG0307 is ----yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 87 (E-value = 3.7e-20) place CPn0532 in the Lum_binding family which is described as Lumazine binding domain (PF00677)
Residues 100 to 180 (E-value = 5.5e-28) place CPn0532 in the Lum_binding family which is described as Lumazine binding domain (PF00677)

PDB Hit:


Gene Protein Sequence:
MFSGIIQELGEVCFFEAQGNGLSLGIKSTPLFVTPLVTGDSVAVDGVCLT
LTSCNESKIFFDVIPETLACTTLGEKRCSDQVNLEAALKMGDSIGGHLLS
GHVFGTAEIFLIKENRYYFRGSKELSQYLFEKGFIAIDGISLTLVSVDSD
TFSVGLIPETLQRTTLGKKREGERVNIEIDMSTKIQVDTVKRILASSGKD
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCAGGAATTATTCAAGAATTAGGTGAAGTGTGTTTTTTTGAAGC
TCAAGGAAATGGTCTGAGTTTAGGAATTAAGAGCACGCCACTATTTGTCA
CCCCTCTGGTTACAGGGGATAGCGTAGCCGTAGATGGAGTCTGTTTGACT
TTAACATCATGCAATGAAAGTAAGATCTTTTTTGATGTGATTCCAGAAAC
TCTAGCTTGTACGACTTTGGGAGAAAAAAGATGTAGCGATCAAGTGAACT
TAGAGGCTGCATTAAAAATGGGAGACTCGATTGGAGGTCACTTACTCTCT
GGGCATGTTTTTGGAACAGCAGAGATTTTCTTGATAAAAGAAAATCGTTA
TTATTTCCGTGGTTCCAAAGAATTATCTCAGTACCTTTTTGAAAAAGGGT
TTATTGCAATTGATGGTATCAGCTTAACGCTAGTGTCAGTTGATAGTGAT
ACGTTTTCTGTGGGATTGATTCCTGAGACTCTTCAAAGGACGACTTTAGG
AAAGAAAAGGGAAGGAGAAAGAGTCAATATCGAGATCGATATGTCAACAA
AGATACAGGTAGACACAGTAAAACGTATTTTAGCCTCATCAGGGAAAGAT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy