Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR420 IGR428 IGR424 IGR419 IGR426 IGR427 IGR429 IGR421 IGR423 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0538 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 ribC, - CPn0532 CPn0531 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0526 CPn0537 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0538 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0531

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (probable methylase)

Gene Start:
614069

Gene Stop:
613242

Gene Length:
828

Molecular Weight*:
31085

pI*:
9.00

Net Charge*:
7.17

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0531 is orthologously related to CT404: residues 1-273 of CPn0531 are 63% similar to residues 2-273 of CT404, a predicted conserved hypothetical protein (probable methylase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1092
COG name: Predicted SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG1092 is -M-k-Qv-Eb-h------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MDYKLLDSGDGNKLECFGPVTLIRPSSIAVWPKSRPELWSQAQLQYVREG
ERGAWKNFKRLPEEWEVAFSDVRCLLKRTPFGHLGVFPEHMGFWPALKQA
IEKHKERQVLNLFAYTGAGSIFAAKCGARVTHVDASQAAVRWAQRNVEKN
AFPERRIFWVIEDVISFLKKEIRRNKKYQVILLDPPSYGRGPDGEVFKID
KDLFPLLSLCSKLLADDASYFLLTSHTPGHTPEFLRAIARRSVPTLVSEA
WSCGESFCGEGVGALPSGSFVQWIA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTATAAATTGCTCGATAGTGGGGACGGGAACAAATTAGAGTGTTT
TGGTCCTGTCACTTTAATTCGTCCTTCAAGTATTGCTGTTTGGCCAAAAA
GCAGACCTGAACTATGGTCTCAGGCGCAATTGCAGTATGTTCGTGAAGGA
GAAAGAGGAGCATGGAAAAATTTTAAGCGTCTTCCTGAAGAATGGGAGGT
CGCATTTTCTGATGTGCGTTGTCTATTGAAGAGAACCCCCTTTGGGCATC
TAGGCGTATTTCCTGAACATATGGGGTTCTGGCCCGCTTTGAAACAAGCC
ATTGAGAAGCACAAAGAACGTCAGGTATTGAATCTCTTTGCTTATACAGG
GGCGGGTTCTATTTTTGCAGCTAAGTGTGGAGCTCGTGTGACCCATGTAG
ATGCTTCGCAGGCAGCGGTACGTTGGGCGCAAAGAAATGTAGAGAAAAAT
GCTTTTCCTGAGAGACGTATTTTTTGGGTTATTGAAGATGTGATTTCTTT
TTTAAAAAAAGAAATCCGCAGAAATAAGAAATATCAAGTGATTCTTTTAG
ATCCCCCAAGCTATGGTCGCGGACCTGATGGGGAAGTATTTAAAATAGAT
AAAGATCTCTTTCCTTTGCTTTCTTTGTGTTCGAAGCTTCTTGCAGATGA
CGCTTCTTATTTTCTCTTAACCTCTCATACTCCAGGACATACCCCAGAGT
TTTTAAGGGCTATAGCTAGGCGTAGCGTGCCAACCCTTGTTTCTGAAGCG
TGGTCTTGTGGGGAAAGTTTTTGTGGAGAAGGTGTGGGAGCCTTGCCTTC
TGGGAGTTTTGTTCAATGGATTGCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy