Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR420 IGR424 IGR419 IGR426 IGR427 IGR421 IGR423 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0537 dksA, - CPn0534 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0533 lspA, - CPn0535 dagA_1, - CPn0536 CPn0537 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0530

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoU_1  

Definition:
23S rRNA methyltransferase

Gene Start:
613254

Gene Stop:
612457

Gene Length:
798

Molecular Weight*:
29990

pI*:
7.00

Net Charge*:
-0.07

EC:
 

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table

Comment:
Belongs to the SpoU family of rRNA methylases.

Blast Summary:  PSI-Blast Search
CPn0530 is orthologously related to CT403: residues 1-262 of
CPn0530 are 57% similar to residues 1-263 of CT403.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0566
COG name: rRNA methylases
Functional Class: J
The phylogenetic pattern of COG0566 is a---YQvCEBRHujgpOLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 116 to 256 (E-value = 1.4e-24) place CPn0530 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

PDB Hit:


Gene Protein Sequence:
MDCIGKHNPLVKEALALKRSRCRKSSWFLVEGAREIQKALRTGYLCQHVF
CSTHLSEKEKEFLYELKRNSTKILYCLDSTLAQLSFKEHHDSFVAVIQKR
VWNKEDFLIQRKNAQPFYLIIEQVEKPGNVGAILRIADGAGVDGVILCNP
IVDLYNPNVVRSSLGAVFSLPILSISREEGKELFKQEGWTVFVTSPRAET
MYFSKNYLGPTALVFGSEKDGLTEDWFSEDFSEIALPMLGESDSLNLATS
VAAVAYEVVRQRWVN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTGCATAGGGAAACATAATCCTCTAGTTAAAGAGGCTCTAGCTTT
AAAACGGTCTCGTTGTAGAAAAAGTTCTTGGTTTCTAGTTGAAGGAGCCC
GTGAGATTCAGAAAGCATTACGCACAGGCTACCTGTGTCAGCATGTTTTT
TGTTCGACACATCTTTCAGAAAAAGAAAAGGAATTTTTATATGAGTTAAA
AAGAAATTCTACAAAGATTTTATATTGCTTAGACTCGACTTTGGCTCAAC
TTTCTTTTAAAGAACATCACGATAGTTTCGTCGCGGTGATACAAAAGAGA
GTGTGGAATAAAGAAGATTTTTTGATCCAACGTAAAAATGCTCAGCCTTT
CTATCTTATTATTGAGCAGGTGGAAAAACCTGGGAATGTCGGTGCTATTT
TAAGAATAGCTGATGGTGCTGGTGTTGACGGTGTGATTTTATGCAATCCT
ATTGTAGATTTGTACAATCCTAATGTGGTGCGCTCTTCTTTAGGAGCTGT
CTTTTCTCTTCCCATCCTCTCTATTTCAAGAGAGGAAGGGAAGGAGTTGT
TCAAGCAGGAAGGCTGGACTGTTTTTGTCACATCTCCTCGAGCTGAAACT
ATGTATTTTTCTAAAAATTATCTTGGTCCCACGGCTTTGGTTTTTGGTTC
AGAGAAAGATGGTTTGACTGAGGATTGGTTTTCTGAAGATTTTTCTGAAA
TCGCTCTTCCTATGTTAGGGGAATCAGATTCTTTGAATCTCGCTACATCT
GTAGCTGCTGTAGCTTATGAAGTTGTTCGTCAACGTTGGGTTAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy