Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR425 IGR420 IGR424 IGR419 IGR426 IGR421 IGR423 IGR418 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 dksA, - CPn0534 CPn0533 lspA, - CPn0535 CPn0525 dagA_1, - CPn0536 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 dksA, - CPn0534 CPn0533 lspA, - CPn0535 CPn0525 dagA_1, - CPn0536 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0533 CPn0525 dagA_1, - CPn0536 dksA, - CPn0534 lspA, - CPn0535
* Calculated from Protein Sequence

Gene ID: CPn0529

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ycaH  

Definition:
probable tetraacyldisaccharide 4'kinase

Gene Start:
612259

Gene Stop:
611162

Gene Length:
1098

Molecular Weight*:
40602

pI*:
10.80

Net Charge*:
23.45

EC:
2.7.1.130  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:
Possible ATPase (ycaH). In E.coli, this enzyme transfers the gamma
phosphate of ATP to the 4' position of tetraacyldisaccharide 1-phosphate (DS-1-P) as
part of lipid A biosynthesis.

Blast Summary:  PSI-Blast Search
CPn0529 is orthologously related to CT402: residues 29-363 of CPn0529 are 51% similar to residues 80-415 of CT402, a predicted tetraacyldisaccharide 4'kinase from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1663
COG name: Lipid A biosynthesis protein LpxK, tetraacyldisaccharide-1-P 4'-kinase
Functional Class:  N
The phylogenetic pattern of COG1663 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 361 (E-value = 3e-223) place CPn0529 in the LpxK family which is described as Tetraacyldisaccharide-1-P 4'-kinase (PF02606)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
25  
44

PDB Hit:


Gene Protein Sequence:
MKKRFPSTLFLFYRRVTIAISLEGILGWGWLGSLLSKVFAFLVACWNRFS
WSTPYRARSTVISVGNIVVGGAGKTPTVLWLAEALRLRGYSCGVLSRGYK
SQSSRQKKLTVVDSKVHSASYVGDEPLLMAEKLPEGSVWVHKDRRISAAR
AAEKFGILLLDDGLQYRKLHKDVEIAVVNGQDPLGGRAFFPKGRLRDFPL
RLKTVDAIIVNGGGKEAGTVVKRVSNAPQIFVKPTIASVVWTHNGERIPK
EALRELRVGVFCGLGFPQGFLNMLREEGIHILGKYLLPDHAAITKKELNY
FCQQMAMRQGQGLLCTEKDSVKLPRLSGEVSLLPIAKVEMRLSVNQDDTL
SLLNMIEQIHKNRGN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACGGTTTCCTTCCACACTCTTTCTCTTTTATCGCCGTGTCAC
CATAGCTATTAGCCTTGAGGGTATTTTGGGATGGGGCTGGTTAGGTTCCC
TTCTTTCCAAAGTTTTTGCATTCTTGGTGGCATGTTGGAATCGATTTTCC
TGGTCTACTCCTTATCGTGCGCGTTCTACAGTCATTAGTGTAGGCAATAT
CGTTGTTGGAGGGGCAGGAAAGACTCCAACAGTATTGTGGTTAGCAGAGG
CTTTGAGGCTTCGAGGGTATTCTTGCGGTGTACTGTCGCGTGGCTATAAA
AGCCAGTCGAGTCGGCAAAAGAAACTGACTGTTGTAGACTCGAAAGTCCA
TTCTGCGTCCTATGTAGGGGACGAGCCTTTATTAATGGCAGAGAAACTGC
CAGAGGGATCCGTATGGGTGCATAAGGACCGGAGGATCTCTGCAGCACGC
GCTGCAGAGAAATTTGGTATTCTCCTTTTAGATGATGGTCTTCAGTACCG
TAAACTACACAAAGACGTAGAAATTGCTGTAGTGAATGGTCAGGATCCTT
TAGGAGGACGTGCCTTCTTCCCTAAAGGAAGGCTTCGGGATTTTCCTCTT
CGATTGAAGACTGTGGATGCCATTATTGTAAATGGCGGTGGAAAAGAGGC
TGGGACTGTAGTGAAACGTGTTTCGAATGCCCCCCAGATCTTTGTGAAAC
CTACAATAGCTTCTGTAGTTTGGACCCATAACGGAGAGCGTATTCCTAAA
GAGGCTCTTCGAGAATTGCGTGTGGGGGTTTTTTGTGGTTTAGGGTTTCC
TCAAGGGTTTTTGAATATGCTTAGAGAAGAAGGAATTCATATTTTAGGAA
AGTATTTATTGCCTGATCACGCAGCAATAACAAAAAAAGAATTAAATTAC
TTTTGTCAGCAAATGGCCATGCGCCAAGGACAAGGGTTGTTATGTACAGA
AAAAGATAGTGTAAAGCTTCCTCGATTATCAGGAGAGGTAAGTTTATTGC
CGATAGCTAAGGTGGAAATGCGCCTTTCTGTGAATCAAGACGATACACTT
TCTCTTCTCAACATGATTGAACAAATACATAAAAACAGGGGTAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy