Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR420 IGR424 IGR419 IGR421 IGR423 IGR417 IGR418 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 dksA, - CPn0534 CPn0533 CPn0525 CPn0524 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 dksA, - CPn0534 CPn0533 CPn0525 CPn0524 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 CPn0533 CPn0525 CPn0524 dksA, - CPn0534
* Calculated from Protein Sequence

Gene ID: CPn0528

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gltT  

Definition:
proton/sodium:glutamate symporter protein

Gene Start:
611162

Gene Stop:
609918

Gene Length:
1245

Molecular Weight*:
43668

pI*:
7.80

Net Charge*:
2.10

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
The GLTT protein in BACST is a Na+ -dependent glutamate-aspartate symporter, an integral membrane protein. In E.coli, glutamate uptake is inhibited by L-cysteate and by beta-hydroxyaspartate.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to amino acid transporter sequences; e.g. residues 1-401 are 81% similar to CT401, a predicted proton/sodium:glutamate symporter protein; residues 1-393 are 26% similar to CT230, a glutamate/aspartate transport carrier permease; residues 3-390 are 24% similar to TP0555, a glutamate/ aspartate transporter; residues 1-400 are 31% similar to (AJ235270) PROTON/SODIUM-GLUTAMATE SYMPORT PROTEIN (gltP) [Rickettsia prowazekii]; residues 25-399 are 30% similar to GLTT_BACST; and residues 30-409 are 28% similar to GLTP_ECOLI.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1301
COG name: Dicarboxylate permease, Na+ or H+ symporter
Functional Class:  C
The phylogenetic pattern of COG1301 is ---k-q--EBrh----oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 55-393 span six regions of similarity to blocks BL00713A-F (Sodium:dicarboxylate symporter family proteins) with a combined E-value of 3.7e-60.

ProDom Summary:  Protein Domain Search
Residues 13-397 are 34% similar to a defined domain of GLTT_BACST, defined as: TRANSPORTER TRANSPORT TRANSMEMBRANE SYMPORT AMINO ACID EXCITATORY GLYCOPROTEIN SODIUM-DEPENDENT PROTEIN.

Paralogs:  Local Blast Search
Residues 7-391 are 26% similar to CPn0289, a predicted glutamate transporter.

Pfam Summary:  Pfam Search
Residues 3 to 396 (E-value = 4e-115) place CPn0528 in the SDF family which is described as Sodium:dicarboxylate symporter family (PF00375)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
279  
414

PDB Hit:


Gene Protein Sequence:
MKLWMKIFIGLFVGVTLGLVLEDKAIFFKPIGDIFLNLLSMVVYPLVFCS
MVLGIASISDMKKLGRIGIKSVGLYLGTTALAIVIGLCFAWIFSPGNGCD
FAQAQSMDSAVTVIDSNKTAAYFLSIIAQVFPSNPVRSFAEGNILQIIIF
AIFLGIALRLSGERGRPVERFIDGFSEIMLRMVNMIMSFAPYGVGASMAW
ISGNHGLGVLWQLGKFIIAYYLACLFHATLVFGGLVRFGCKMSFSKFLSS
MMDAISCAVSTASSSATLPVTMRCVSKNLGVSAEVSGFVLPLGATVNMNG
TAIFQGMAAVFIAQAYNCPLSLSSLLLLVVTATFSAVGSAGVPGGGMITL
GSVLASVGLPIQGIAILAGIDRLRDIVGTPMNILGDAVVATYVASGEGEL
SPYESIKQESVETT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTATGGATGAAGATCTTTATTGGATTGTTTGTCGGGGTTACCTT
AGGTTTAGTTTTAGAAGATAAAGCCATCTTTTTTAAACCTATAGGAGACA
TCTTTTTAAATCTATTGAGCATGGTAGTGTATCCTTTAGTGTTCTGCTCA
ATGGTTTTAGGAATCGCTTCCATTAGCGATATGAAAAAATTGGGACGCAT
TGGCATTAAAAGTGTCGGCCTCTATCTAGGGACTACGGCACTAGCTATTG
TGATTGGCTTGTGTTTTGCTTGGATTTTCTCTCCAGGAAATGGGTGTGAT
TTTGCCCAGGCCCAATCTATGGATTCGGCCGTTACTGTCATTGATTCAAA
CAAAACAGCGGCGTATTTTCTTTCTATAATAGCTCAAGTTTTCCCATCGA
ATCCTGTACGCTCTTTTGCTGAAGGGAATATATTACAAATTATTATTTTT
GCGATTTTCTTAGGAATTGCCCTTCGGCTTTCTGGAGAACGTGGCCGCCC
TGTCGAGCGTTTTATTGATGGTTTTTCTGAAATCATGTTGCGCATGGTAA
ATATGATCATGAGTTTTGCTCCCTATGGTGTGGGAGCTAGCATGGCATGG
ATTTCGGGAAATCATGGTTTAGGAGTCCTTTGGCAGCTAGGCAAATTTAT
CATTGCTTACTATCTGGCGTGTTTGTTCCATGCTACGCTTGTTTTTGGGG
GACTTGTGCGTTTTGGTTGCAAGATGTCCTTTTCGAAGTTTCTCTCTTCA
ATGATGGATGCGATTTCTTGCGCGGTATCTACAGCGAGTAGTTCTGCGAC
TTTACCTGTAACGATGCGTTGTGTTTCTAAAAATTTGGGAGTGTCCGCTG
AGGTTTCTGGTTTTGTTTTGCCTCTAGGCGCCACTGTGAATATGAATGGA
ACTGCAATTTTTCAGGGTATGGCAGCGGTTTTCATTGCTCAAGCATACAA
TTGTCCGCTATCCTTGAGCAGTCTGTTATTATTGGTAGTTACCGCAACAT
TCTCTGCCGTGGGTAGTGCCGGTGTTCCTGGAGGAGGTATGATTACTCTG
GGTTCCGTATTAGCCTCTGTAGGTTTACCTATCCAGGGTATCGCTATACT
TGCTGGGATTGACCGGTTAAGGGATATTGTAGGTACACCCATGAATATTC
TTGGGGATGCTGTAGTTGCTACTTATGTAGCTTCTGGAGAAGGAGAGCTT
TCTCCTTATGAATCGATAAAACAGGAAAGCGTTGAAACTACATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy