Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR422 IGR420 IGR419 IGR416 IGR415 IGR421 IGR417 IGR418 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0523 CPn0522 CPn0525 CPn0524 ribC, - CPn0532 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 CPn0523 CPn0522 CPn0525 CPn0524 CPn0531 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 spoU_1, - CPn0530 spoU_1, - CPn0530 ribC, - CPn0532 CPn0522 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0527

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sucB  

Definition:
dihydrolipoamide 5-succinyltransferas

Gene Start:
609904

Gene Stop:
608723

Gene Length:
1182

Molecular Weight*:
42473

pI*:
5.10

Net Charge*:
-9.00

EC:
2.3.1.61  

Functional Class:
energy metabolism; TCA cycle  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0527 is similar to MG272, a predicted
dihydrolipoamide acetyltransferase E2 component
in M. genitalium.

CPn0527 is orthologously related to CT400:
residues 2-392 are 72% similar to CT400. CPn0527
is also similar to CT055.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0508
COG name: Dihydrolipoamide acyltransferases
Functional Class:  C
The phylogenetic pattern of COG0508 is ----Y--cEBRH--gp--INX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0527 is paralogously related to CPn0377, also
predicted dihydrolipoamide succinyltransferase and
to CPn0306, a predicted dihydrolipoamide acetyltransferase.


Pfam Summary:  Pfam Search
Residues 3 to 76 (E-value = 2.6e-22) place CPn0527 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)
Residues 111 to 150 (E-value = 8.2e-14) place CPn0527 in the E3_binding family which is described as e3 binding domain (PF02817)
Residues 163 to 392 (E-value = 5.3e-106) place CPn0527 in the 2-oxoacid_dh family which is described as 2-oxoacid dehydrogenases acyltransferase (catalytic domain) (PF00198)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
33  
127
transmembrane  
321  
338

PDB Hit:


Gene Protein Sequence:
MIFEFRFPKIGETSSGGSIVRWLKNLGDHVARDEPLIEVSTDKIATELPS
PKAGRLVRFCVNEGDEVASGDVLGLIELEEISEADDESTSCPPTSCETKS
EAGSSSSSVWFSPAVLSLAQREGIGLDNLQKIAGTGKGGRVTRQDLEAYI
SESQQVSIPEIFQGEVNRIPMSPLRRAIASSLSKSSDEVPHASLVVDVDV
TDLMNLISGERQRFLDTHGVKLTITSFIVQCLAQTLRQFPLLNGSLDGTT
IVMKKSVNVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKALADLSSRARLN
KLDPSEVQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRD
DDSLAIRKMVYVTLTFDHRVLDGIYGSEFLTSLKNRLESVTMG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATATTTGAGTTCCGATTCCCTAAAATAGGAGAGACGAGTTCCGGAGG
ATCTATAGTCCGTTGGTTAAAAAATTTGGGTGATCATGTAGCTAGAGATG
AGCCTCTGATTGAAGTATCTACGGATAAAATTGCTACAGAATTACCCTCT
CCTAAAGCAGGCCGACTGGTGCGTTTCTGCGTCAATGAGGGAGACGAGGT
TGCTTCTGGGGATGTTTTAGGATTGATAGAGCTTGAGGAGATTTCCGAAG
CTGATGATGAGAGCACCTCATGTCCTCCGACTTCTTGTGAAACAAAGTCG
GAGGCGGGTTCCAGCAGTTCTTCGGTATGGTTTTCTCCTGCCGTGCTGAG
TTTAGCTCAACGTGAAGGCATTGGTCTTGATAACCTCCAAAAGATTGCCG
GCACGGGGAAAGGGGGACGAGTGACTCGTCAGGATTTAGAAGCGTATATT
TCAGAATCGCAACAAGTTTCTATTCCCGAAATATTTCAAGGAGAAGTGAA
TCGCATTCCTATGTCTCCGCTACGTCGGGCAATAGCTTCTTCTCTCTCCA
AGTCTTCAGATGAGGTTCCTCACGCATCTTTGGTTGTTGATGTCGATGTC
ACAGATCTTATGAATCTGATTTCTGGTGAACGCCAACGCTTCTTAGATAC
GCATGGGGTGAAGCTAACGATTACAAGTTTCATTGTACAGTGTTTAGCTC
AGACTTTAAGGCAGTTTCCTTTATTGAATGGTTCCTTAGATGGGACTACC
ATTGTTATGAAGAAATCTGTGAATGTAGGCGTTGCCGTGAACCTCAATAA
GGAAGGGGTTGTTGTTCCTGTCATCCACAATTGTCAAGATCGCGGTTTAG
TAAGTATTGCAAAGGCCTTGGCGGATCTATCTTCAAGGGCTCGGTTAAAT
AAATTGGATCCTAGTGAAGTGCAAGATGGCAGCGTTACTGTCACGAATTT
TGGAATGACGGGAGCTTTGATTGGGATGCCCATCATACGTTATCCTGAAG
TTGCTATTTTAGGAATTGGCACAATACAAAAACGTGTTGTCGTCCGTGAT
GACGATTCTTTAGCCATTCGCAAAATGGTCTATGTGACACTTACCTTTGA
CCATAGAGTATTGGATGGTATTTACGGCAGTGAGTTTTTAACCTCATTGA
AAAATCGTTTGGAGTCTGTTACGATGGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy