Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR420 IGR419 IGR416 IGR415 IGR414 IGR421 IGR417 IGR418 spoU_1, - CPn0530 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 spoU_1, - CPn0530 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 spoU_1, - CPn0530 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0522 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0526

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible sugar phosphate isomerase)

Gene Start:
608696

Gene Stop:
607707

Gene Length:
990

Molecular Weight*:
35638

pI*:
6.00

Net Charge*:
-5.26

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible gutQ superfamily member with CBS domains or YrbH.
The GUTQ protein in E.coli appears to be a homodimer that contains two
CBS domains.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to GutQ/KpsF Family Sugar-P Isomerases; e.g. residues 1-329 are 100% similar to (AE001637) GutQ/KpsF Family Sugar-P Isomerase [Chlamydia pneumoniae]; residues 4-329 are 59% similar to (AE001313) GutQ/KpsF Family Sugar-P Isomerase [Chlamydia trachomatis]; residues 46-328 are 37% similar to (AE000745) polysialic acid capsule expression protein [Aquifex aeolicus]; and residues 39-329 are 35% similar to YRBH_ECOLI, a hypothetical protein sequence and putative isomerase.

BLAST reveals no significant similarity to M.genitalium, T.pallidum, or U.ureaplasma.

CPn0526 is orthologously related to CT399: residues 4-329 of CPn0526 are 59% similar to residues 4-328 of CT399, a predicted conserved hypothetical protein (possible sugar phosphate isomerase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0794
COG name: Predicted sugar phosphate aminotransferases involved in capsule formation
Functional Class:  M
The phylogenetic pattern of COG0794 is amTk-q-cEb-huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 74-143 are 42% similar to a defined domain of KSF1_ECOLI.

Residues 211-310 are 37% similar to a defined domain of O67500_AQUAE, defined as PROTEIN DEHYDROGENASE CBS BIOSYNTHESIS DOMAIN REPEAT INOSINE-5'-MONOPHOSPHATE CHANNEL IMP IMPD.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 39 to 176 (E-value = 1.6e-19) place CPn0526 in the SIS family which is described as SIS domain (PF01380)
Residues 206 to 259 (E-value = 2.4e-07) place CPn0526 in the CBS family which is described as CBS domain (PF00571)
Residues 272 to 328 (E-value = 2e-06) place CPn0526 in the CBS family which is described as CBS domain (PF00571)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
125  
143
transmembrane  
160  
177
transmembrane  
226  
243

PDB Hit:


Gene Protein Sequence:
MPSPMISTDVCQDILGKQKEAVDFFFQAFQPKEAMQLAEKILGHSGWVFF
SGVGKSGCVARKLVATLQSLSERALFFSPVDLLHGDLGLVSPGDIVCLFS
KSGETQELLDTVPHLKSRRAILVAITSMPYSNLAALSDLVVILPSVAELD
PFNLIPTNSTTCQMIFGDFLAMLLFHSRGVSLSTYGKNHPSGQVGMKANG
KVKDFMFPKTEVPFCHLGDKVSFSLEVFSAYGCGCVCIVDPQFRLMGIFT
DGDLRRSLASYGGEVLSLSLEKVMTANPRCITEDSDIAIALQLMESSSPV
AVLPVLDNEENRHVTGLLHMHTLAKAGLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTCCCCGATGATTTCTACTGACGTATGCCAAGACATTCTAGGTAA
GCAAAAAGAAGCTGTAGATTTTTTTTTCCAAGCCTTTCAACCCAAAGAGG
CAATGCAATTAGCAGAAAAAATACTCGGTCATTCGGGATGGGTATTTTTT
TCTGGTGTAGGGAAAAGTGGATGTGTAGCACGAAAATTAGTGGCTACACT
CCAATCTTTAAGTGAACGTGCTCTGTTCTTTTCTCCTGTGGATCTTCTGC
ACGGGGATCTTGGTCTTGTGAGTCCTGGAGACATTGTATGTTTATTTTCT
AAAAGTGGTGAAACCCAAGAGTTACTAGATACGGTTCCTCATCTAAAGAG
TCGAAGGGCGATTCTTGTCGCGATTACTTCCATGCCTTATTCTAATTTAG
CGGCTCTCTCGGACTTAGTCGTTATTTTACCCTCTGTTGCTGAATTAGAT
CCTTTTAATTTAATCCCTACAAATTCTACGACATGCCAAATGATCTTTGG
AGATTTTTTAGCTATGCTCCTTTTTCATAGTCGTGGTGTTTCTTTATCTA
CGTACGGCAAAAACCATCCTAGTGGGCAGGTTGGGATGAAGGCTAATGGT
AAGGTTAAAGATTTTATGTTCCCAAAGACAGAGGTACCTTTCTGTCATCT
TGGAGATAAAGTGAGTTTTTCTTTAGAGGTCTTTTCTGCTTACGGTTGTG
GTTGTGTTTGTATAGTAGATCCTCAATTCCGACTTATGGGAATTTTTACA
GACGGAGATTTACGGCGTTCTTTAGCTTCCTATGGGGGGGAGGTGCTTTC
GTTATCTTTGGAGAAGGTGATGACGGCAAATCCTCGATGTATTACTGAAG
ATTCGGATATTGCCATTGCTTTGCAACTTATGGAATCTAGTAGTCCTGTA
GCTGTTCTTCCTGTTTTAGATAACGAGGAGAACCGACATGTGACTGGCTT
GTTGCATATGCACACTTTAGCCAAAGCTGGTCTACTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy