Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR420 IGR413 IGR419 IGR416 IGR415 IGR414 IGR417 IGR418 clp_1, - CPn0520 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 clp_1, - CPn0520 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 clp_1, - CPn0520 CPn0526 ycaH, - CPn0529 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0522 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0525

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
606522

Gene Stop:
607286

Gene Length:
765

Molecular Weight*:
29576

pI*:
8.50

Net Charge*:
4.53

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0525 is orthologously related to CT398: residues 1-254 of CPn0525 are 82% similar to residues 1-254 of CT398, a predicted conserved hypothetical protein from C. trachomatis.
CPn0525 is also similar to TP0494, a predicted conserved hypothetical protein from T. pallidum.


COGS Summary:  COGS Search
BeTs to 6 clades of COG1579
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1579 is -----q------uj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 234 (E-value = 8.1e-107) place CPn0525 in the DUF164 family which is described as Uncharacterized ACR, COG1579 (PF02591)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
11  
170

PDB Hit:


Gene Protein Sequence:
MHDALLSILAIQELDIKMIRLMRVKKEHQKELAKVQSLKSDIRRKVQEKE
LEMENLKTQIRDGENRIQEISEQINKLENQQAAVKKMDEFNALTQEMTTA
NKERRSLEHQLSDLMDKQAGGEDLIVSLKESLASTENSSSVIEKEIFESI
KKINEEGKALLEQRTELKHATNPELLSIYERLLNNKKDRVVVPIENRVCS
GCHIVLTPQHENLVRKKDRLIFCEHCSRILYWQESQVNAQENSTAKRRRR
RAAV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATGACGCACTTCTAAGCATTTTGGCTATTCAAGAGCTTGATATTAA
AATGATTCGCCTTATGCGCGTAAAGAAAGAACATCAGAAAGAATTGGCTA
AAGTCCAATCTTTAAAAAGTGATATTCGTAGAAAAGTTCAGGAAAAAGAA
CTCGAAATGGAGAATTTGAAAACTCAAATTCGAGATGGAGAGAATCGCAT
CCAAGAGATTTCTGAACAAATCAATAAATTAGAAAATCAGCAAGCTGCTG
TAAAAAAAATGGATGAGTTTAACGCTCTTACCCAAGAAATGACTACAGCA
AACAAAGAACGTCGCTCTTTAGAGCACCAGCTTAGCGATCTCATGGATAA
GCAAGCTGGAGGCGAAGACCTTATTGTCTCTCTAAAAGAAAGCTTAGCTT
CTACAGAAAATAGTAGCAGTGTCATTGAAAAAGAAATTTTTGAAAGCATC
AAAAAGATTAATGAAGAAGGCAAAGCTTTGCTTGAACAACGGACAGAGTT
AAAGCATGCGACGAATCCCGAACTACTCAGCATCTATGAGCGTCTATTAA
ACAATAAAAAAGATCGCGTTGTTGTTCCTATTGAAAATCGTGTCTGCAGT
GGTTGTCATATTGTTCTAACTCCTCAACACGAAAATCTTGTAAGAAAGAA
AGACCGACTCATTTTTTGCGAACATTGCTCTCGAATTCTCTATTGGCAAG
AATCCCAAGTCAATGCTCAGGAAAATTCCACAGCAAAACGTCGTCGTCGT
CGCGCAGCTGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy