Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR420 IGR413 IGR419 IGR416 IGR415 IGR412 IGR414 IGR417 IGR418 dapF, - CPn0519 CPn0518 CPn0526 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 dapF, - CPn0519 CPn0518 CPn0526 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 CPn0518 CPn0526 sucB, - CPn0527 gltT, - CPn0528 glyA, - CPn0521 clp_1, - CPn0520 clp_1, - CPn0520 dapF, - CPn0519 CPn0522 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0524

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
605103

Gene Stop:
606182

Gene Length:
1080

Molecular Weight*:
39940

pI*:
6.90

Net Charge*:
-0.26

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
While this sequence shows weak similarity to CPn0370 which is defined as having similarity to CT058, no significant similarity to this or any other C.trachomatis sequence is observed.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of hit to C.pneumoniae sequence.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Weak (insignificant?) similarity to a possible paralog in C.pneumoniae:

Residues 29-329 are 23% similar to residues 25-343 of CPn0370, which is defined as a hypothetical protein.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
35  
59
transmembrane  
64  
81
transmembrane  
278  
295

PDB Hit:


Gene Protein Sequence:
MSGPSRTESSQVSVLSYVPRDKEIAPKKQFTIAKISTLAILASLALGALV
AGISLTIVLGNPVFLALLITTALFSVVTFLVYHQMTSKVSSNWQKVLEQN
FKPLGKAWQEKNVDCYSNEMQFYNNHLNPKFKVAIQTDASQPFQPTFLTG
LRVIEKNQSTGIIFNPVGPTNLIDNTATNLSTILYSTLKDKSVWDTCKQR
EGGPAKGEDPFSPTEVRVVKLPNEALDQTFNLNLSSAEKKSILPTFLGHV
CGPKSEELPNQQEYYRQALLAYENCLKAAIESHAAIVALPLFTSVYEVPP
EEILPKEGTFYWDNQTQAFCKRALLDAIQNTALRYPQRSLLVILQDPFNT
IESQSRSEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGGACCCTCACGTACTGAGAGCTCTCAAGTTTCTGTACTATCCTA
TGTGCCTCGGGATAAAGAAATTGCTCCTAAAAAACAGTTTACCATAGCAA
AAATATCCACTCTTGCAATCCTAGCTTCTTTAGCTTTAGGAGCTTTGGTG
GCTGGAATCTCTTTAACGATAGTATTAGGGAACCCTGTATTTTTGGCTCT
TCTCATTACCACGGCCCTCTTCTCAGTTGTAACCTTCTTAGTCTACCACC
AAATGACCTCAAAGGTATCTTCTAACTGGCAGAAAGTTCTAGAGCAAAAC
TTCAAGCCTTTGGGAAAAGCGTGGCAAGAAAAAAACGTAGACTGCTACTC
AAACGAGATGCAATTTTACAATAATCACCTGAACCCTAAGTTCAAGGTAG
CGATACAAACAGATGCGTCTCAACCATTTCAGCCTACTTTCTTAACTGGA
CTTAGAGTGATCGAAAAAAATCAATCCACAGGGATCATCTTTAATCCCGT
AGGCCCAACGAATCTGATCGACAACACTGCAACGAACCTCTCTACTATCC
TTTACTCCACCCTAAAAGATAAAAGCGTGTGGGATACATGCAAGCAACGC
GAAGGGGGTCCCGCAAAAGGAGAAGACCCCTTTTCCCCTACCGAAGTGAG
AGTAGTAAAACTTCCAAACGAAGCTCTAGATCAAACGTTTAATCTAAATT
TAAGCTCTGCAGAAAAGAAAAGTATTCTTCCGACCTTTTTAGGCCACGTA
TGCGGCCCTAAATCTGAAGAGTTACCAAATCAGCAAGAATATTATCGCCA
AGCTTTACTAGCGTACGAGAACTGCCTTAAAGCAGCTATAGAAAGTCATG
CAGCAATCGTTGCTCTTCCTCTCTTTACTTCGGTCTATGAAGTGCCTCCA
GAAGAGATTCTTCCTAAAGAAGGCACTTTCTATTGGGACAACCAAACTCA
AGCGTTTTGCAAACGCGCTTTATTGGACGCTATTCAAAATACGGCCCTAC
GCTATCCTCAAAGATCTTTACTTGTTATACTCCAAGATCCTTTTAATACT
ATAGAATCACAAAGTCGTTCTGAGGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy