Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR419 IGR416 IGR415 IGR412 IGR414 IGR417 IGR418 dapF, - CPn0519 CPn0518 CPn0526 sucB, - CPn0527 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 dapF, - CPn0519 CPn0518 CPn0526 sucB, - CPn0527 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 dapF, - CPn0519 CPn0518 CPn0526 sucB, - CPn0527 glyA, - CPn0521 clp_1, - CPn0520 clp_1, - CPn0520 CPn0522 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0523

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
604723

Gene Stop:
605055

Gene Length:
333

Molecular Weight*:
12186

pI*:
8.80

Net Charge*:
3.79

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
49
transmembrane  
54  
72

PDB Hit:


Gene Protein Sequence:
MASSATPGFDGTAPSLFPPATRPRYNFKLALFVTIAIALVWIALIATTIA
IGLCIHPLCSFIFLTAIPLYFISRYICSHYARNVYIALDVVPDHSKLQDM
RSHSPIFSDR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTCTTCAGCTACTCCCGGTTTTGATGGAACGGCTCCCTCTCTATT
TCCCCCAGCTACTCGTCCTCGCTATAATTTCAAGCTTGCCCTCTTCGTTA
CTATTGCGATTGCACTCGTCTGGATAGCTCTGATTGCTACCACCATAGCT
ATTGGGCTATGTATCCACCCTTTGTGCTCCTTTATCTTCCTAACAGCAAT
TCCCTTATACTTTATATCTCGCTATATTTGCTCCCACTACGCACGCAATG
TCTACATAGCTCTAGATGTCGTCCCCGATCATTCTAAATTGCAAGACATG
CGCTCTCACTCTCCAATTTTCTCGGATCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy