Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR419 IGR416 IGR415 IGR412 IGR414 IGR411 IGR417 IGR418 dapF, - CPn0519 CPn0517 CPn0518 CPn0526 sucB, - CPn0527 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 dapF, - CPn0519 CPn0517 CPn0518 CPn0526 sucB, - CPn0527 glyA, - CPn0521 CPn0523 CPn0522 CPn0525 CPn0524 dapF, - CPn0519 CPn0518 CPn0526 sucB, - CPn0527 glyA, - CPn0521 clp_1, - CPn0520 clp_1, - CPn0520 CPn0517 CPn0522 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0522

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
603987

Gene Stop:
604658

Gene Length:
672

Molecular Weight*:
25712

pI*:
11.20

Net Charge*:
27.09

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0522 is orthologously related to CT433, a Chlamydia-specific hypothetical protein.
Residues 1-203 are 43% similar to CT433.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 10 to 223 (E-value = 7.5e-68) place CPn0522 in the HEM4 family which is described as Uroporphyrinogen-III synthase HemD (PF02602)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
115

PDB Hit:


Gene Protein Sequence:
MTLYLGLNQKTARKYQAHYLPILTLFPYAKSTPQNKRALQFLPQATHVIL
TSPSSTHLFLSRMTSLLSKATLKTKTYLCIGESTKERLLSFLGQVKYVVA
TQEIAEGIFPLLQALPSSARILYPHSSLARPVIREFLYNRFTFFSYPHYT
VKPRKLKKNILSKYKKIIFTSPSTVRAFAKIFPRFPEKTYWCQGRMTLQE
FQKFSSQKQVSLLETLGKSRTSP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCTCTACTTAGGATTGAATCAAAAAACCGCTCGTAAATACCAAGC
TCATTATTTGCCTATTCTAACTCTCTTCCCCTATGCAAAAAGCACTCCAC
AAAATAAGCGTGCTCTTCAATTCCTTCCACAAGCAACCCATGTGATTCTC
ACAAGTCCCTCATCCACTCACCTATTCCTTTCCAGAATGACTTCTCTTCT
TTCTAAGGCCACTCTAAAAACAAAGACCTACCTCTGTATAGGAGAGTCCA
CCAAAGAAAGACTTCTCTCTTTCCTTGGACAAGTGAAGTACGTAGTAGCA
ACTCAAGAAATCGCTGAAGGCATCTTCCCATTGCTACAGGCACTGCCCTC
TTCAGCCCGCATTCTCTACCCCCACTCCTCCCTCGCAAGACCTGTGATCA
GAGAATTTCTTTACAATCGATTTACTTTTTTCTCTTACCCTCACTACACA
GTGAAGCCGCGAAAACTTAAAAAAAATATTTTATCTAAATACAAAAAAAT
TATCTTCACAAGCCCTTCAACTGTAAGAGCTTTCGCCAAAATCTTTCCGC
GATTTCCTGAAAAAACCTACTGGTGCCAAGGAAGGATGACCTTGCAGGAG
TTTCAAAAGTTCTCCTCTCAAAAGCAGGTATCTTTGTTAGAAACGCTTGG
GAAGTCCAGGACATCTCCGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy