Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR416 IGR415 IGR410 IGR412 IGR414 IGR411 IGR417 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0523 CPn0522 ubiE, - CPn0515 CPn0525 CPn0524 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0523 CPn0522 ubiE, - CPn0515 CPn0525 CPn0524 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 clp_1, - CPn0520 CPn0517 clp_1, - CPn0520 CPn0517 CPn0522 ubiE, - CPn0515 CPn0525 CPn0524 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0520

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
clp_1  

Definition:
Clp protease

Gene Start:
602218

Gene Stop:
601643

Gene Length:
576

Molecular Weight*:
21005

pI*:
5.70

Net Charge*:
-3.08

EC:
3.4.21.92  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Comment:
For reviews, see, "THE CLP ATPASES DEFINE A NOVEL CLASS OF MOLECULAR CHAPERONES." 1996. WAWRZYNOW A, BANECKI B, ZYLICZ M. MOLECULAR MICROBIOLOGY 21(5): 895-899 and "New insights into the ATP-dependent Clp protease: Escherichia coli and beyond." 1999. Porankiewicz J, Wang JM, Clarke AK. MOLECULAR MICROBIOLOGY 32(3): 449-458.

In E.coli, this enzyme cleaves peptides internally in a process
that uses ATP. It is a dimeric protein that requires a regulatory subunit
(clpA or clpX) as well as this proteolytic subunit. It is the proteolytic subunit of the protease Ti.

From Prosite PDOC00358:

The endopeptidase Clp (EC 3.4.21.92) from Escherichia coli cleaves
peptides in various proteins in a process that requires ATP
hydrolysis. Clp is a dimeric protein which consists of a
proteolytic subunit (gene clpP) and either of two related
ATP-binding regulatory subunits (genes clpA and clpX). ClpP is a
serine protease which has a chymotrypsin-like activity. Its
catalytic activity seems to be provided by a charge relay system
similar to that of the trypsin family of serine proteases, but
which evolved by independent convergent evolution.

Proteases highly similar to ClpP have been found to be encoded in
the genome of the chloroplast of plants and seem to be also present
in other eukaryotes.

Blast Summary:  PSI-Blast Search
CPn0520 is orthologously related to CT431: residues 1-191 of CPn0520 are 84% similar to residues 1-192 of CT431, a predicted ATP-dependent ClpP endopeptidase from C. trachomatis.
CPn0520 is also similar to CT706, TP0507, TP1041.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0520 is paralogous to CPn0847: residues 13-187 of CPn0520 are 41% similar to residues 20-192 of CPn0847, a predicted Clp protease from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 188 (E-value = 8.4e-85) place CPn0520 in the CLP_protease family which is described as Clp protease (PF00574)

PDB Hit:


Gene Protein Sequence:
MADGEVHKLRDIIEKELLEARRVFFSEPVTEKSASDAIKKLWYLELKDPG
KPIVFVINSPGGSVDAGFAVWDQIKMLTSPVTTVVTGLAASMGSVLSLCA
APGRRFATPHSRIMIHQPSIGGPITGQATDLDIHAREILKTKARIIDVYV
EATNQPRDIIEKAIDRDMWMTANEAKDFGLLDGILFSFNDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGACGGGGAAGTTCATAAATTACGTGATATTATAGAAAAAGAGTT
ATTGGAAGCGCGCAGAGTATTTTTCTCAGAGCCTGTAACAGAGAAAAGTG
CTTCCGATGCAATTAAAAAGCTTTGGTATTTGGAATTAAAAGATCCTGGA
AAGCCTATAGTTTTTGTGATCAATAGTCCTGGGGGATCTGTGGACGCAGG
TTTTGCTGTTTGGGATCAAATTAAAATGTTAACCTCACCCGTCACTACTG
TTGTGACAGGGTTGGCAGCTTCTATGGGCTCGGTATTGAGTTTATGTGCA
GCTCCTGGAAGGAGATTTGCAACTCCTCATTCTAGAATTATGATTCATCA
ACCTTCAATAGGTGGACCGATTACCGGTCAGGCAACCGATTTAGACATTC
ATGCGAGAGAGATTTTAAAAACAAAAGCTCGCATTATAGATGTCTATGTA
GAGGCGACAAATCAACCTCGAGATATCATAGAAAAGGCTATCGATAGAGA
TATGTGGATGACAGCCAACGAAGCTAAGGATTTTGGTTTATTGGATGGCA
TTTTATTCTCCTTCAACGATCTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy