Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR416 IGR415 IGR410 IGR412 IGR414 IGR411 IGR417 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0523 CPn0522 CPn0514 CPn0524 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0523 CPn0522 CPn0514 CPn0524 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 clp_1, - CPn0520 CPn0517 clp_1, - CPn0520 CPn0517 CPn0522 CPn0524 ubiE, - CPn0515 CPn0514 CPn0523 ubiE, - CPn0515
* Calculated from Protein Sequence

Gene ID: CPn0519

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapF  

Definition:
diaminopimelate epimerase

Gene Start:
601674

Gene Stop:
600901

Gene Length:
774

Molecular Weight*:
28309

pI*:
6.60

Net Charge*:
-1.65

EC:
5.1.1.7  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis

Comment:
See CPn1047 (dapB) and CPn1050 (dapA).

Blast Summary:  PSI-Blast Search
CPn0519 is orthologously related to CT430, a predicted diaminopimelate epimerase:
residues 1-254 are 54 % similar to CT430. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 12 to 121 (E-value = 4.4e-06) place CPn0519 in the DAP_epimerase family which is described as Diaminopimelate epimerase (PF01678)
Residues 139 to 256 (E-value = 2.4e-18) place CPn0519 in the DAP_epimerase family which is described as Diaminopimelate epimerase (PF01678)

PDB Hit:


Gene Protein Sequence:
MAFYSPSTISKYFIYSGAGNRFLLGETLPEVEDVRFLCQETRVDGFLYLK
PSSCADAQLIIFNSDGSRPTMCGNGLRCAIAHLASQKGKSDISVSTDSGL
YSGYFYSWDRVLVDMTLADWRASVHRLESRPDPLPKEVVCIHTGVPHAVV
ILPEISTLDLSILGPFLRYHQTFSPDGVNVNFVQILGHCQLRVRTYERGV
EGETAACGTGALASALVVSNSYGWKESIQIHTWGGELMTVSQNRGRVYLQ
GSVTRDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATTTTATTCTCCTTCAACGATCTCTAAATATTTTATCTATTCTGG
AGCAGGAAATCGTTTCCTTCTTGGTGAAACACTTCCTGAGGTTGAAGATG
TTCGGTTCTTATGCCAAGAGACGAGGGTTGATGGTTTTTTATATTTAAAG
CCCTCTTCTTGTGCTGATGCGCAACTCATTATTTTTAATTCCGATGGATC
ACGTCCAACGATGTGTGGTAACGGCTTGCGTTGTGCGATTGCTCACTTAG
CTTCTCAGAAGGGAAAATCGGACATCTCTGTATCTACGGATAGTGGTCTA
TATTCAGGATATTTTTATTCTTGGGATCGTGTGCTTGTAGATATGACTCT
CGCAGATTGGAGAGCTTCTGTTCATCGATTGGAGTCGCGTCCTGATCCTC
TTCCCAAAGAGGTCGTTTGTATCCATACGGGAGTGCCTCATGCTGTCGTA
ATTCTTCCTGAGATTTCTACTTTAGATCTTTCTATCTTAGGTCCTTTTCT
TCGCTATCATCAGACCTTCTCTCCAGATGGGGTGAATGTCAATTTTGTTC
AGATACTGGGACATTGCCAGTTGCGCGTTCGTACTTACGAACGTGGAGTC
GAAGGGGAAACTGCAGCTTGTGGAACAGGGGCTCTAGCTTCTGCTCTTGT
TGTGTCAAACTCCTATGGATGGAAGGAGTCGATCCAAATCCATACTTGGG
GTGGAGAGCTTATGACTGTGAGTCAAAATAGGGGACGGGTATATCTTCAG
GGCTCTGTAACTAGAGATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy