Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR416 IGR415 IGR410 IGR412 IGR414 IGR411 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0523 CPn0522 ubiE, - CPn0515 CPn0524 CPn0513 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0523 CPn0522 ubiE, - CPn0515 CPn0524 CPn0513 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 clp_1, - CPn0520 CPn0517 clp_1, - CPn0520 CPn0517 ubiE, - CPn0515 CPn0524 CPn0514 CPn0513 CPn0522 CPn0514 CPn0523
* Calculated from Protein Sequence

Gene ID: CPn0518

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
600803

Gene Stop:
599829

Gene Length:
975

Molecular Weight*:
38297

pI*:
5.40

Net Charge*:
-5.28

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0518 is orthologously related to CT429, a Chlamydia-specific hypothetical protein.
Residues 1-323 are 84% similar to CT429.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 170 (E-value = 4.7e-111) place CPn0518 in the UPF0158 family which is described as Uncharacterised protein family (UPF0158) (PF03682)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
42  
69
non-globular  
232  
324

PDB Hit:


Gene Protein Sequence:
MMTYPVPQNPLLLRILRLMDAFSKSDDERDFYLDRVEGFILYIDLDKDQE
DLNKIYQELEENAERYCLIPKLTFYEVKKIMETFINEKIYDIDTKEKFLE
ILQSKNAREQFLEFIYDHEAELEKWQQFYVERSRIRIIEWLRNNKFHFVF
EEDLDFTKNVLEQLKIHLFDAKVGKEITQARQLLSNKAKIYYSNEALNPR
PKRGRPPKQSAKVETETTISSDIYTKVPQAARRFLFLPEITSPSSITFSE
KFDTEEEFLANLRGSTRVEDQLNLTNLSERFASLKELSAKLGYDSLSTGD
FFGDDDEKVVTKTKGSKRGRKKSS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGACGTATCCTGTACCACAAAACCCACTTCTTTTAAGAATCCTTCG
TCTTATGGATGCATTCTCTAAGTCTGACGATGAGAGGGACTTTTATTTAG
ATCGTGTTGAAGGGTTTATTCTCTACATAGATTTAGATAAAGACCAAGAG
GATCTAAATAAGATTTACCAAGAATTAGAAGAGAATGCCGAGCGGTATTG
TTTGATTCCGAAGTTGACGTTTTATGAAGTAAAAAAAATCATGGAAACGT
TTATCAATGAAAAGATTTATGATATCGATACCAAAGAAAAGTTCCTTGAG
ATTTTGCAATCCAAGAATGCCCGTGAGCAGTTTTTAGAGTTTATTTATGA
TCACGAGGCAGAGTTAGAAAAGTGGCAGCAATTTTATGTAGAGCGTTCTC
GAATTCGAATTATAGAATGGCTTCGCAATAATAAGTTCCATTTTGTCTTT
GAAGAAGATCTAGATTTCACAAAGAATGTTTTGGAACAGTTGAAAATACA
TTTGTTTGATGCCAAGGTGGGGAAAGAAATCACTCAAGCGCGTCAGTTGT
TGTCGAACAAAGCTAAGATTTACTATTCCAATGAAGCATTAAACCCTCGT
CCGAAACGAGGCCGTCCTCCGAAGCAATCTGCTAAGGTAGAAACAGAAAC
AACAATTTCGAGTGATATTTATACAAAAGTCCCTCAGGCTGCTCGTCGTT
TCCTTTTCTTACCCGAGATTACTTCACCCTCTTCAATTACTTTCTCAGAA
AAATTTGATACGGAAGAAGAATTTCTTGCTAACTTGCGCGGTTCGACTCG
TGTTGAAGACCAGCTGAATCTTACCAATCTTTCAGAGAGGTTTGCTTCTC
TTAAAGAGCTTTCGGCTAAGCTTGGTTACGACTCTCTTTCTACTGGAGAT
TTCTTTGGTGATGATGATGAGAAAGTGGTCACTAAGACGAAGGGGAGCAA
GCGAGGCCGCAAAAAATCTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy