Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR410 IGR412 IGR414 IGR411 IGR409 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0522 ubiE, - CPn0515 CPn0513 CPn0512 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 CPn0522 ubiE, - CPn0515 CPn0513 CPn0512 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 clp_1, - CPn0520 CPn0517 clp_1, - CPn0520 CPn0517 CPn0522 ubiE, - CPn0515 CPn0512 CPn0514 CPn0514 CPn0513
* Calculated from Protein Sequence

Gene ID: CPn0517

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
599631

Gene Stop:
598792

Gene Length:
840

Molecular Weight*:
31309

pI*:
8.20

Net Charge*:
5.55

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
40  
64
transmembrane  
69  
92

PDB Hit:


Gene Protein Sequence:
MSSLLSCGRIEPTRVTCSLKTYLEDTSQNQLSTRLVRASVIFLCALLIIL
VCVALSSLIPSIMALATSFTVMGLILFVMSLLGDVAIISYLTYSTVTSYR
QNKRAFEIHKPARSVYYEGVRHWDLGRSSLGTGEIPIVRTLFSPFQNHGL
NHALAAKIFLFMEHFSPEPPNEPLVDWACLIRDFRPHVSSLCFVIEKQGS
SLRTKEGNTICEAFRSDYDAHFAMVDCYRLIHSKLIIEKMGLKNIDIIPS
VMVREDYPSRPGEGYREGLLRMYGGKGAL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATCACTACTGAGCTGCGGAAGAATAGAGCCGACTCGGGTTACCTG
TAGCTTAAAGACGTATCTTGAGGATACGAGTCAGAATCAGTTGAGCACAC
GTCTAGTTCGGGCAAGTGTCATCTTTTTATGCGCATTGTTGATCATTTTG
GTTTGTGTGGCCCTCTCTAGTTTGATTCCAAGCATTATGGCCTTGGCGAC
CTCTTTTACGGTAATGGGGTTAATTCTTTTTGTGATGTCACTTCTTGGTG
ACGTTGCAATTATAAGTTATCTTACTTATAGCACTGTTACGAGTTACCGG
CAAAATAAGAGAGCTTTTGAGATTCACAAGCCCGCTCGCTCCGTTTACTA
CGAGGGGGTCCGCCATTGGGATTTAGGACGATCATCTTTAGGCACAGGCG
AGATTCCTATAGTAAGGACGTTATTCTCTCCATTTCAGAACCATGGTCTT
AACCATGCCTTAGCTGCTAAAATTTTCCTATTTATGGAGCATTTCAGCCC
TGAGCCACCGAACGAGCCTTTGGTGGATTGGGCCTGTTTGATTCGGGATT
TTAGGCCTCACGTCAGTTCTTTGTGCTTTGTTATTGAAAAACAAGGGTCA
TCGCTGAGGACTAAGGAAGGCAATACGATTTGTGAGGCTTTCCGCTCTGA
TTACGACGCCCATTTTGCTATGGTAGATTGCTACCGGTTGATCCACTCTA
AGTTGATTATAGAGAAAATGGGATTGAAGAATATCGATATCATTCCGAGT
GTCATGGTTCGTGAAGATTATCCTAGCCGTCCTGGGGAGGGCTATCGCGA
AGGCCTATTACGTATGTATGGTGGCAAGGGGGCTCTGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy