Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR413 IGR410 IGR412 IGR411 IGR409 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 ubiE, - CPn0515 CPn0513 CPn0512 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 ubiE, - CPn0515 CPn0513 CPn0512 dapF, - CPn0519 CPn0518 glyA, - CPn0521 CPn0516 clp_1, - CPn0520 CPn0517 clp_1, - CPn0520 CPn0517 ubiE, - CPn0515 CPn0513 CPn0512 CPn0514 CPn0514
* Calculated from Protein Sequence

Gene ID: CPn0516

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
598814

Gene Stop:
597252

Gene Length:
1563

Molecular Weight*:
58023

pI*:
4.80

Net Charge*:
-16.20

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
147  
251

PDB Hit:


Gene Protein Sequence:
MVARGLCDFPTLVPNERLPIGPFFVPQHTSGAKGKEFAKRNFSIISGLDD
ILKLCILQRRPFALQWDNLSVKSDYEEAGPAIGIRSLEPQVSQISPAHGR
LCSTLVQWAPILGSEEQLVWLEETMKRLKFPKSLGSKDAVIVDSEMVPVN
ANPTQEIPAASETVESSPVAPGNTTDTMPAASGTTDTTSGVSEAAAAEAA
VDSTPGTEEEPSFSLRYALVVQNVPYPEPPKEPEVMFTDEEKSLILEATR
ARRMELDLYNGYLADYELSKDEIQKHVPDLPENWRTNWRWSERLYKFFFK
TKKEGLEEIFLNKELGNMILARGLAATQSQARIKVFNSLVAWLLQSFNVG
RSCTAKPLPTSKLDLFKSEFESKPKNNILTEFLVASDEEILFKGLRVLEP
GIEGWYDHPDQAGEIRSVLEGLVQAGRISGYWENQPFGRFVLRGVGERRT
ELVELLESLVASGEIMQFFESSDEEGAFIIDNEPSKTAMLKQRFKSCVRT
KLVGSFADESLPRGRFTILV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTGGCAAGGGGGCTCTGTGACTTCCCTACTTTAGTTCCTAATGAGCG
CTTGCCCATAGGGCCTTTCTTTGTCCCGCAGCACACTTCCGGTGCGAAGG
GTAAGGAGTTTGCTAAAAGGAATTTTTCTATAATTTCGGGATTGGATGAC
ATATTAAAATTATGTATTCTTCAAAGGCGTCCTTTTGCTTTGCAGTGGGA
TAACCTCTCTGTGAAAAGTGATTATGAGGAGGCTGGGCCCGCTATTGGGA
TACGTTCTCTTGAGCCACAAGTTTCTCAAATTTCTCCAGCCCACGGCCGG
CTATGTAGTACTTTGGTCCAGTGGGCCCCTATCCTTGGTTCTGAGGAGCA
GCTAGTTTGGTTAGAAGAAACAATGAAGCGCCTAAAGTTTCCTAAAAGTT
TAGGTAGTAAGGACGCTGTTATTGTGGATTCGGAAATGGTTCCTGTGAAC
GCCAATCCTACTCAAGAGATACCTGCAGCTTCCGAGACTGTAGAGTCTTC
ACCTGTAGCTCCAGGGAATACAACAGATACCATGCCTGCAGCTTCGGGAA
CTACAGACACCACATCTGGGGTTTCAGAGGCTGCGGCGGCTGAGGCTGCC
GTGGATTCTACACCAGGGACAGAGGAGGAGCCGAGTTTTTCTCTGAGGTA
TGCGCTTGTAGTTCAAAATGTTCCCTATCCAGAGCCGCCTAAAGAACCTG
AGGTGATGTTTACAGATGAAGAAAAAAGTCTGATTTTAGAAGCTACTCGT
GCGCGTCGTATGGAGTTGGACTTGTATAATGGCTATTTAGCTGATTATGA
ACTTTCTAAGGATGAAATACAGAAACACGTTCCTGATTTACCTGAGAATT
GGCGTACGAATTGGCGTTGGTCGGAGAGGCTCTATAAATTTTTCTTTAAA
ACAAAGAAAGAAGGATTAGAAGAAATTTTCTTAAACAAAGAGTTAGGGAA
TATGATTCTTGCCCGAGGGCTGGCGGCAACTCAGTCACAAGCACGTATTA
AAGTATTCAATTCTTTAGTGGCATGGCTCTTGCAAAGCTTTAACGTAGGG
AGGAGCTGTACAGCTAAACCTCTTCCTACGTCAAAACTAGACCTCTTTAA
ATCGGAATTCGAGTCTAAGCCTAAAAATAACATCTTAACGGAATTTTTGG
TGGCCTCTGATGAGGAGATTCTCTTTAAGGGGCTACGGGTCCTAGAGCCT
GGAATCGAAGGTTGGTATGACCATCCTGATCAAGCTGGAGAGATTCGGTC
GGTACTCGAGGGTCTGGTGCAGGCTGGACGTATTTCTGGATATTGGGAGA
ATCAGCCGTTTGGGAGATTTGTCCTTAGAGGAGTTGGTGAAAGACGTACC
GAGCTTGTAGAGCTTTTGGAGAGTTTAGTTGCTTCTGGTGAGATTATGCA
GTTCTTTGAGTCTTCGGATGAAGAGGGTGCTTTTATTATCGATAACGAAC
CTAGCAAGACTGCTATGCTAAAACAGCGATTTAAGAGTTGTGTCAGGACG
AAGCTTGTCGGGAGTTTTGCTGATGAGAGTCTTCCCAGAGGTAGGTTTAC
CATTTTAGTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy