Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR408 IGR410 IGR412 IGR407 IGR411 IGR409 dapF, - CPn0519 CPn0518 CPn0516 rsbv, - CPn0511 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 dapF, - CPn0519 CPn0518 CPn0516 rsbv, - CPn0511 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 dapF, - CPn0519 CPn0518 CPn0516 clp_1, - CPn0520 CPn0517 CPn0517 clp_1, - CPn0520 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 CPn0514 CPn0514 rsbv, - CPn0511
* Calculated from Protein Sequence

Gene ID: CPn0515

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiE  

Definition:
probable ubiquinone/menaquinone methyltransferase

Gene Start:
596492

Gene Stop:
597184

Gene Length:
693

Molecular Weight*:
25623

pI*:
10.10

Net Charge*:
11.25

EC:
2.1.1.-  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Alkaloid biosynthesis I
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Comment:
In B.subtilis, the GRC2 protein methylates (using S-adenosyl-methionine ) demethylmenaquinol to form menaquinol. It is also known as spore germination protein C2.

Blast Summary:  PSI-Blast Search
CPn0515 is similar to CT428, a probable menaquinone methyltransferase.
Residues 6-229 are 51% similar to CT428. It is weakly similar to CT133,
a hypothetical. No similarity to T.pallidum, M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG2226
COG name: Methylase involved in ubiquinone/menaquinone biosynthesis UbiE/COQ5
Functional Class:  H
The phylogenetic pattern of COG2226 is ----yqvcebr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 229 (E-value = 6.1e-24) place CPn0515 in the Ubie_methyltran family which is described as ubiE/COQ5 methyltransferase family (PF01209)

PDB Hit:


Gene Protein Sequence:
MEPSTNKPDCKKIFDSIASKYDRTNTILSLGMHHFWNRSLIQILGSGYSL
LDLCAGTGKVAKRYIAAHPQASVTLVDFSSAMLDIAKQHLPQGSCSFIHS
DINQLPLENHSYPLAAMAYGLRNLSDPHKALQEISRVLMPSGKLGILELT
PPKKTHPTYSAHKLYLRAVVPWIGKSVSKDPDAYSYLSKSIQQLPKDHDL
EDLFSKSGFYIAKKKKLFLGAATIWLLEKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACCCTCTACCAACAAGCCCGACTGTAAAAAGATCTTCGATTCCAT
AGCGAGTAAGTATGATCGCACAAATACAATACTCTCTTTAGGAATGCACC
ATTTCTGGAATCGCTCTTTGATCCAGATCCTAGGGTCGGGATACTCTCTC
CTGGATCTCTGCGCAGGAACAGGAAAAGTCGCGAAGCGTTATATTGCCGC
ACACCCTCAAGCATCAGTAACTCTCGTCGACTTTTCCTCAGCAATGCTCG
ACATTGCAAAACAACACCTTCCCCAGGGCTCTTGCTCTTTTATTCATAGC
GATATTAATCAACTGCCCTTGGAGAATCATTCTTATCCCCTAGCAGCGAT
GGCCTATGGCCTCAGGAACCTCTCGGATCCACATAAAGCCCTACAAGAAA
TCTCCCGAGTGCTTATGCCTTCTGGAAAACTGGGCATTCTAGAGCTCACA
CCTCCAAAAAAAACACACCCTACCTATAGTGCCCATAAGCTCTATTTGCG
TGCTGTCGTCCCCTGGATTGGAAAGTCTGTTTCTAAAGATCCCGACGCCT
ATAGCTATCTCAGCAAAAGTATCCAGCAACTTCCAAAGGACCACGATCTT
GAAGACCTATTCTCTAAATCAGGATTTTATATTGCGAAAAAGAAAAAATT
GTTCCTAGGAGCGGCTACGATTTGGCTACTAGAGAAACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy