Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR408 IGR410 IGR412 IGR407 IGR411 IGR409 dapF, - CPn0519 CPn0518 CPn0516 rsbv, - CPn0511 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 dapF, - CPn0519 CPn0518 CPn0516 rsbv, - CPn0511 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 dapF, - CPn0519 CPn0518 CPn0516 CPn0517 CPn0517 rsbv, - CPn0511 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 CPn0514 CPn0514
* Calculated from Protein Sequence

Gene ID: CPn0514

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
595729

Gene Stop:
596523

Gene Length:
795

Molecular Weight*:
29737

pI*:
6.80

Net Charge*:
-1.07

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0514 is weakly related to hypothetical proteins in Archeaoglobus fulgidus (AE001077), in Aquifex aeolicus (AE000721) and in Bacillus firmus (U61168). No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0514 is orthologously related to CT427, a conserved hypothetical protein: residues 1-263 are 45% similar to CT427.



COGS Summary:  COGS Search
BeTs to 4 clades of COG1427
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1427 is a----q------uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 263 (E-value = 1e-167) place CPn0514 in the DUF178 family which is described as Uncharacterized ACR, COG1427 (PF02621)

PDB Hit:


Gene Protein Sequence:
MSNQLQPCISLGCVSYINSFPLSLQLIKRNDIRCVLAPPADLLNLLIEGK
LDVALTSSLGAISHNLGYVPGFGIAANQRILSVNLYAAPTFFNSPQPRIA
ATLESRSSIGLLKVLCRHLWRIPTPHILRFITTKVLRQTPENYDGLLLIG
DAALQHPVLPGFVTYDLASGWYDLTKLPFVFALLLHSTSWKEHPLPNLAM
EEALQQFESSPEEVLKEAHQHTGLPPSLLQEYYALCQYRLGEEHYESFEK
FREYYGTLYQQARL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAACCAACTCCAGCCATGTATAAGCTTAGGCTGCGTAAGTTATAT
TAATTCCTTTCCGCTGTCCCTACAACTCATAAAAAGAAACGATATTCGCT
GTGTTCTTGCTCCCCCTGCAGACCTCCTCAACTTGCTAATCGAAGGGAAA
CTCGATGTTGCTTTGACCTCATCCCTAGGAGCTATCTCTCATAACTTGGG
GTATGTCCCCGGCTTTGGAATTGCAGCAAACCAACGTATCCTCAGTGTAA
ACCTCTATGCAGCTCCCACTTTCTTTAACTCACCGCAACCTCGGATTGCC
GCAACTTTAGAAAGTCGCTCCTCTATAGGACTCTTAAAAGTGCTTTGTCG
TCATCTCTGGCGCATCCCAACTCCTCATATCCTAAGATTCATAACTACAA
AAGTACTCAGACAAACCCCTGAAAATTATGATGGCCTCCTCCTAATCGGA
GATGCAGCGCTACAACATCCTGTACTTCCTGGATTTGTAACCTATGACCT
TGCCTCGGGGTGGTATGATCTTACAAAGCTACCTTTTGTATTTGCTCTTC
TTCTACACAGCACCTCTTGGAAAGAACATCCCCTACCCAACCTTGCGATG
GAAGAAGCCCTCCAACAGTTCGAATCTTCACCCGAAGAAGTCCTTAAAGA
AGCTCATCAACATACAGGTCTGCCCCCTTCTCTTCTTCAAGAATACTATG
CCCTATGCCAGTACCGTCTAGGAGAAGAACACTACGAAAGCTTTGAAAAA
TTCCGGGAATATTATGGAACCCTCTACCAACAAGCCCGACTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy